Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120005
Name   oriT_p3Z-5L-4 in_silico
Organism   Klebsiella quasipneumoniae strain 3Z-5L
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP072519 (43087..43192 [-], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_p3Z-5L-4
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   12610 GenBank   WP_224052337
Name   traI_J6325_RS28365_p3Z-5L-4 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75261.05 Da        Isoelectric Point: 9.9948

>WP_224052337.1 TraI/MobA(P) family conjugative relaxase [Klebsiella quasipneumoniae]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETVLAVKSDMFEGLNNYLIRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQNTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNIRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(87-334)


  Protein structure



No available structure.




T4CP

ID   14808 GenBank   WP_011091092
Name   t4cp2_J6325_RS28245_p3Z-5L-4 insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79491.81 Da        Isoelectric Point: 4.8270

>WP_011091092.1 MULTISPECIES: hypothetical protein [Gammaproteobacteria]
MQQESVDSKKVIRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMHFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFADWLDGTDTDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 12439..40291

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J6325_RS28200 (J6325_28055) 7744..8064 + 321 WP_077820004 chromosome segregation protein ParM -
J6325_RS28205 (J6325_28060) 8067..8915 + 849 WP_176453632 3'-5' exonuclease -
J6325_RS28210 (J6325_28065) 8938..10203 - 1266 WP_040224115 translesion error-prone DNA polymerase V subunit UmuC -
J6325_RS28215 (J6325_28070) 10191..10625 - 435 WP_176453630 LexA family transcriptional regulator -
J6325_RS28220 (J6325_28075) 10778..11431 - 654 WP_176453629 CPBP family intramembrane glutamic endopeptidase -
J6325_RS28225 (J6325_28080) 11511..11894 + 384 WP_176453642 DUF1496 domain-containing protein -
J6325_RS28230 (J6325_28085) 12119..12394 + 276 WP_004206888 lytic transglycosylase domain-containing protein -
J6325_RS28235 (J6325_28090) 12439..13701 + 1263 WP_224052342 conjugal transfer protein TrbA trbA
J6325_RS28240 (J6325_28095) 13712..14662 + 951 WP_004187441 DsbC family protein trbB
J6325_RS28245 (J6325_28100) 14675..16762 + 2088 WP_011091092 hypothetical protein -
J6325_RS28250 (J6325_28105) 16810..17319 + 510 WP_023302492 MucR family transcriptional regulator -
J6325_RS28605 17374..17469 - 96 WP_004206884 DinQ-like type I toxin DqlB -
J6325_RS28255 (J6325_28110) 18694..19749 - 1056 WP_224052343 plasmid replication initiator RepA -
J6325_RS28260 (J6325_28115) 20047..20295 - 249 WP_015062836 IncL/M type plasmid replication protein RepC -
J6325_RS28265 (J6325_28120) 20352..21005 - 654 WP_004187494 hypothetical protein -
J6325_RS28270 (J6325_28125) 21008..23188 - 2181 WP_004187492 DotA/TraY family protein traY
J6325_RS28275 (J6325_28130) 23181..23831 - 651 WP_011091083 hypothetical protein -
J6325_RS28280 (J6325_28135) 23828..25036 - 1209 WP_011091082 conjugal transfer protein TraW traW
J6325_RS28285 (J6325_28140) 25033..28083 - 3051 WP_031942490 plasmid transfer protein traU
J6325_RS28290 (J6325_28145) 28080..28574 - 495 WP_015243645 hypothetical protein -
J6325_RS28295 (J6325_28150) 28620..29009 - 390 WP_011091078 DUF6750 family protein traR
J6325_RS28300 (J6325_28155) 29026..29556 - 531 WP_011091077 conjugal transfer protein TraQ traQ
J6325_RS28305 (J6325_28160) 29580..30284 - 705 WP_224052344 conjugal transfer protein TraP traP
J6325_RS28310 (J6325_28165) 30296..31645 - 1350 WP_015062830 conjugal transfer protein TraO traO
J6325_RS28315 (J6325_28170) 31657..32808 - 1152 WP_011091074 DotH/IcmK family type IV secretion protein traN
J6325_RS28320 (J6325_28175) 32817..33530 - 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
J6325_RS28325 (J6325_28180) 33598..34008 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
J6325_RS28330 (J6325_28185) 34037..34192 + 156 WP_172693602 Hha/YmoA family nucleoid-associated regulatory protein -
J6325_RS28335 (J6325_28190) 34193..34705 - 513 WP_011091071 hypothetical protein traL
J6325_RS28340 34671..38063 - 3393 WP_224052335 LPD7 domain-containing protein -
J6325_RS28345 (J6325_28200) 38088..38348 - 261 WP_004187310 IcmT/TraK family protein traK
J6325_RS28350 (J6325_28205) 38338..39501 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
J6325_RS28355 (J6325_28210) 39512..40291 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
J6325_RS28360 (J6325_28215) 40288..40788 - 501 WP_004187320 DotD/TraH family lipoprotein -
J6325_RS28365 (J6325_28220) 40802..42781 - 1980 WP_224052337 TraI/MobA(P) family conjugative relaxase -
J6325_RS28370 42768..43346 - 579 WP_224052338 plasmid mobilization protein MobA -
J6325_RS28375 (J6325_28230) 43361..43726 + 366 WP_004187330 hypothetical protein -
J6325_RS28380 (J6325_28235) 44227..44763 - 537 WP_015062822 hypothetical protein -
J6325_RS28385 (J6325_28240) 44896..45207 - 312 WP_224052339 hypothetical protein -

Host bacterium

ID   20435 GenBank   NZ_CP072519
Plasmid name   p3Z-5L-4 Incompatibility group   IncL/M
Plasmid size   59397 bp Coordinate of oriT [Strand]   43087..43192 [-]
Host baterium   Klebsiella quasipneumoniae strain 3Z-5L

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -