Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   119902
Name   oriT_EMBL-1|unnamed1 in_silico
Organism   Klebsiella variicola strain EMBL-1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP079803 (57912..57961 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_EMBL-1|unnamed1
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   14762 GenBank   WP_060598860
Name   traD_KU883_RS27785_EMBL-1|unnamed1 insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 85363.18 Da        Isoelectric Point: 4.9167

>WP_060598860.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 60419..88060

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KU883_RS27590 (KU883_27575) 56792..57322 + 531 WP_077138878 antirestriction protein -
KU883_RS27595 (KU883_27580) 57360..57767 - 408 WP_224230374 transglycosylase SLT domain-containing protein -
KU883_RS27600 (KU883_27585) 58261..58659 + 399 WP_077138880 conjugal transfer relaxosome DNA-binding protein TraM -
KU883_RS27605 (KU883_27590) 58832..59518 + 687 WP_060598875 transcriptional regulator TraJ family protein -
KU883_RS27610 (KU883_27595) 59597..59983 + 387 WP_004152495 TraY domain-containing protein -
KU883_RS27615 (KU883_27600) 60037..60405 + 369 WP_049155512 type IV conjugative transfer system pilin TraA -
KU883_RS27620 (KU883_27605) 60419..60724 + 306 WP_004178059 type IV conjugative transfer system protein TraL traL
KU883_RS27625 (KU883_27610) 60744..61310 + 567 WP_004194424 type IV conjugative transfer system protein TraE traE
KU883_RS27630 (KU883_27615) 61297..62037 + 741 WP_060598874 type-F conjugative transfer system secretin TraK traK
KU883_RS27635 (KU883_27620) 62037..63461 + 1425 WP_060598873 F-type conjugal transfer pilus assembly protein TraB traB
KU883_RS27640 (KU883_27625) 63454..64050 + 597 WP_060598872 conjugal transfer pilus-stabilizing protein TraP -
KU883_RS27645 (KU883_27630) 64073..64657 + 585 WP_060598871 type IV conjugative transfer system lipoprotein TraV traV
KU883_RS27650 (KU883_27635) 64789..65199 + 411 WP_060598870 hypothetical protein -
KU883_RS27655 (KU883_27640) 65204..65488 + 285 WP_060598886 hypothetical protein -
KU883_RS27660 (KU883_27645) 65512..65736 + 225 WP_060598869 hypothetical protein -
KU883_RS27665 (KU883_27650) 65729..66040 + 312 WP_077138882 hypothetical protein -
KU883_RS27670 (KU883_27655) 66107..66511 + 405 WP_060598867 hypothetical protein -
KU883_RS27675 (KU883_27660) 66554..66877 + 324 WP_072124277 hypothetical protein -
KU883_RS27680 (KU883_27665) 66885..67283 + 399 WP_072198239 hypothetical protein -
KU883_RS27685 (KU883_27670) 67355..69994 + 2640 WP_219163328 type IV secretion system protein TraC virb4
KU883_RS27690 (KU883_27675) 69994..70383 + 390 WP_020803372 type-F conjugative transfer system protein TrbI -
KU883_RS27695 (KU883_27680) 70383..71009 + 627 WP_020314628 type-F conjugative transfer system protein TraW traW
KU883_RS27700 (KU883_27685) 71053..72012 + 960 WP_029497356 conjugal transfer pilus assembly protein TraU traU
KU883_RS27705 (KU883_27690) 72027..72575 + 549 WP_022631518 hypothetical protein -
KU883_RS27710 (KU883_27695) 72550..73239 - 690 WP_032427592 hypothetical protein -
KU883_RS27715 (KU883_27700) 73296..73898 + 603 WP_077138883 hypothetical protein -
KU883_RS27720 (KU883_27705) 74043..74690 + 648 WP_039698503 type-F conjugative transfer system pilin assembly protein TrbC trbC
KU883_RS27725 (KU883_27710) 74749..76704 + 1956 WP_060598862 type-F conjugative transfer system mating-pair stabilization protein TraN traN
KU883_RS27730 (KU883_27715) 76737..77018 + 282 WP_022644736 hypothetical protein -
KU883_RS27735 (KU883_27720) 77008..77235 + 228 WP_012540032 conjugal transfer protein TrbE -
KU883_RS27740 (KU883_27725) 77246..77572 + 327 WP_012539967 hypothetical protein -
KU883_RS27745 (KU883_27730) 77593..78345 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
KU883_RS27750 (KU883_27735) 78356..78595 + 240 WP_023340931 type-F conjugative transfer system pilin chaperone TraQ -
KU883_RS27755 (KU883_27740) 78567..79124 + 558 WP_032433944 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
KU883_RS27760 (KU883_27745) 79170..79613 + 444 WP_040172400 F-type conjugal transfer protein TrbF -
KU883_RS27765 (KU883_27750) 79591..80970 + 1380 WP_072198238 conjugal transfer pilus assembly protein TraH traH
KU883_RS27770 (KU883_27755) 80970..83792 + 2823 WP_060598861 conjugal transfer mating-pair stabilization protein TraG traG
KU883_RS27775 (KU883_27760) 83816..84418 + 603 WP_048263624 hypothetical protein -
KU883_RS27780 (KU883_27765) 84669..85400 + 732 WP_016831056 conjugal transfer complement resistance protein TraT -
KU883_RS27785 (KU883_27770) 85760..88060 + 2301 WP_060598860 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   20332 GenBank   NZ_CP079803
Plasmid name   EMBL-1|unnamed1 Incompatibility group   IncFIA
Plasmid size   98922 bp Coordinate of oriT [Strand]   57912..57961 [-]
Host baterium   Klebsiella variicola strain EMBL-1

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -