Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 119638 |
| Name | oriT_pSECR18-1644_KPC |
| Organism | Klebsiella aerogenes strain 18-1644 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MT129535 (103243..103291 [-], 49 nt) |
| oriT length | 49 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | 32..33 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_pSECR18-1644_KPC
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 14570 | GenBank | WP_040120372 |
| Name | traD_H5H66_RS00100_pSECR18-1644_KPC |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85972.07 Da Isoelectric Point: 5.1806
>WP_040120372.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTNSHAGEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTNSHAGEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 2731..19553
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H5H66_RS00010 (18-1644_00002) | 2342..2731 | + | 390 | WP_020803372 | type-F conjugative transfer system protein TrbI | - |
| H5H66_RS00015 (18-1644_00003) | 2731..3366 | + | 636 | WP_020325113 | type-F conjugative transfer system protein TraW | traW |
| H5H66_RS00020 (18-1644_00004) | 3401..3802 | + | 402 | WP_004194979 | hypothetical protein | - |
| H5H66_RS00025 (18-1644_00005) | 3799..4788 | + | 990 | WP_029497420 | conjugal transfer pilus assembly protein TraU | traU |
| H5H66_RS00030 (18-1644_00006) | 4801..5439 | + | 639 | WP_015065635 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| H5H66_RS00035 (18-1644_00007) | 5498..7453 | + | 1956 | WP_101455617 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| H5H66_RS00040 (18-1644_00008) | 7485..7739 | + | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
| H5H66_RS00045 (18-1644_00009) | 7717..7965 | + | 249 | WP_004152675 | hypothetical protein | - |
| H5H66_RS00050 (18-1644_00010) | 7978..8304 | + | 327 | WP_134874471 | hypothetical protein | - |
| H5H66_RS00055 (18-1644_00011) | 8325..9077 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| H5H66_RS00060 (18-1644_00012) | 9088..9327 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| H5H66_RS00065 (18-1644_00013) | 9299..9856 | + | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| H5H66_RS00070 (18-1644_00014) | 9902..10345 | + | 444 | WP_101455614 | F-type conjugal transfer protein TrbF | - |
| H5H66_RS00075 (18-1644_00015) | 10323..11702 | + | 1380 | WP_072198320 | conjugal transfer pilus assembly protein TraH | traH |
| H5H66_RS00080 (18-1644_00016) | 11702..14545 | + | 2844 | WP_134874469 | conjugal transfer mating-pair stabilization protein TraG | traG |
| H5H66_RS00085 (18-1644_00017) | 14556..15089 | + | 534 | WP_004197891 | hypothetical protein | - |
| H5H66_RS00090 (18-1644_00018) | 15499..16230 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| H5H66_RS00095 (18-1644_00019) | 16423..17112 | + | 690 | WP_074182184 | hypothetical protein | - |
| H5H66_RS00100 (18-1644_00020) | 17241..19553 | + | 2313 | WP_040120372 | type IV conjugative transfer system coupling protein TraD | virb4 |
Region 2: 102685..109360
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H5H66_RS00565 (18-1644_00106) | 98734..99114 | + | 381 | WP_020802391 | hypothetical protein | - |
| H5H66_RS00570 (18-1644_00107) | 99181..99528 | + | 348 | WP_032445771 | hypothetical protein | - |
| H5H66_RS00575 (18-1644_00108) | 99623..99769 | + | 147 | WP_004152750 | hypothetical protein | - |
| H5H66_RS00580 (18-1644_00109) | 99820..100653 | + | 834 | WP_032445769 | N-6 DNA methylase | - |
| H5H66_RS00585 | 100988..101164 | + | 177 | WP_159376550 | hypothetical protein | - |
| H5H66_RS00590 (18-1644_00111) | 101469..102290 | + | 822 | WP_004152492 | DUF932 domain-containing protein | - |
| H5H66_RS00595 | 102323..102652 | + | 330 | WP_011977736 | DUF5983 family protein | - |
| H5H66_RS00600 (18-1644_00112) | 102685..103170 | - | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
| H5H66_RS00605 (18-1644_00113) | 103602..103994 | + | 393 | WP_004194114 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| H5H66_RS00610 (18-1644_00114) | 104224..104925 | + | 702 | WP_040120380 | hypothetical protein | - |
| H5H66_RS00615 | 105011..105211 | + | 201 | WP_046664192 | TraY domain-containing protein | - |
| H5H66_RS00620 (18-1644_00115) | 105279..105647 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| H5H66_RS00625 (18-1644_00116) | 105661..105966 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| H5H66_RS00630 (18-1644_00117) | 105986..106552 | + | 567 | WP_064161971 | type IV conjugative transfer system protein TraE | traE |
| H5H66_RS00635 (18-1644_00118) | 106539..107279 | + | 741 | WP_064169777 | type-F conjugative transfer system secretin TraK | traK |
| H5H66_RS00640 (18-1644_00119) | 107279..108703 | + | 1425 | WP_040228261 | F-type conjugal transfer pilus assembly protein TraB | traB |
| H5H66_RS00645 (18-1644_00120) | 108776..109360 | + | 585 | WP_040120377 | type IV conjugative transfer system lipoprotein TraV | traV |
| H5H66_RS00650 | 109683..109901 | + | 219 | WP_004195468 | hypothetical protein | - |
| H5H66_RS00655 (18-1644_00122) | 109902..110213 | + | 312 | WP_029497417 | hypothetical protein | - |
| H5H66_RS00660 | 110280..110684 | + | 405 | WP_004197817 | hypothetical protein | - |
| H5H66_RS00685 | 110727..110879 | + | 153 | WP_224518895 | hypothetical protein | - |
| H5H66_RS00670 (18-1644_00123) | 111061..111459 | + | 399 | WP_023179972 | hypothetical protein | - |
Host bacterium
| ID | 20068 | GenBank | NZ_MT129535 |
| Plasmid name | pSECR18-1644_KPC | Incompatibility group | IncFII |
| Plasmid size | 111828 bp | Coordinate of oriT [Strand] | 103243..103291 [-] |
| Host baterium | Klebsiella aerogenes strain 18-1644 |
Cargo genes
| Drug resistance gene | blaKPC-2, blaOXA-9 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |