Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   119630
Name   oriT_SB18003|unnamed in_silico
Organism   Escherichia sp. SB18003
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP141234 (71452..71524 [-], 73 nt)
oriT length   73 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 73 nt

>oriT_SB18003|unnamed
GTCGGGGCAAAGCCCTGACCAGGTGGGGAATGTCTGAGTGCGCGTGCGCGGTCCGACATTCCCACATCCTGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   12407 GenBank   WP_029391987
Name   Relaxase_VJF75_RS00435_SB18003|unnamed insolico UniProt ID   A0A2H5C199
Length   906 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 906 a.a.        Molecular weight: 105112.51 Da        Isoelectric Point: 8.2682

>WP_029391987.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterobacteriaceae]
MNAIIPHKRRDGRSSFEDLIAYTSVRDDVQENELTEDSEIKSDVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCNSLETAAEEMQYKADKAVFSRNDTDPVFHYILSWPAHESPRPEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINWLSWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRHFAERLPEMARNGELESCLDVHRTLAKAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLMT
LDYMQDLDGGWQPVPKDIFTQVIPGERFRGHSIGTQAVSDYEWYRMRMGTGPQGAIKRELFSDKESLWGY
ALIQCRSQIEEMIAGGDFSWQACHEMFARKGLMLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEP
QAGPFEIAGADIFERVKPECRYNPELAASDEVEPGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRK
PDLRYGERLREIHAACRRRKAYIRVQFRDPQVRKLHYHIAEVQRMQALIRLKESVKEERLSLIAEGKWYP
LSYRQWVEQQAAQGDRAAVSQLRGWDYRDRRSRNKDKRRTTNADRCVVLCEPGGTPLFNNVAKLEARLQK
NGSVHFRDTRTGKNVCTDYGDRVVFYHHTDRNELAEKLDLIAPVLFSRNGKLGFEPEGSYQQFNDVFAEM
VAWHNAAGITGNGHFTITRPDVDLHRQRSEQYYREYIRQQTRLSESHDDNYTLRQEKTWEPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure


Source ID Structure
AlphaFold DB A0A2H5C199


Auxiliary protein

ID   7063 GenBank   WP_001291058
Name   WP_001291058_SB18003|unnamed insolico UniProt ID   A0A7I0L241
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12730.52 Da        Isoelectric Point: 9.9656

>WP_001291058.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRTGSENRKRIVKFTARFTEDEAEIVREKAESSGQTVSTFIRSSSLDKVVNCRTDDRMIDEIMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITEYVNALRRDLMGR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L241


T4CP

ID   14564 GenBank   WP_029392471
Name   trbC_VJF75_RS00440_SB18003|unnamed insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 87239.20 Da        Isoelectric Point: 6.6676

>WP_029392471.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSQHHVNPDLIHRTAWGNPLWNALHNLNIIGLCLAGSIITALIWPLALPVCLLFTLVTSVIFTLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETSPARGIFYVGYRRINDIGRELWLSMDDLTRHII
FFSTTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTTRTIWYLSRRFGREDDIEVINFMNGGKSRSEI
IQSGEKSRPQSNTWNPFAFSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVRERKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFITQQSMILARDLGYRLE
GTDAQTLEVKKYKGRFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMMAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGLMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYIAIEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTEKTSRKRRKKHTEPYRIIDTFQDQLKRTQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEILLPVAENNKSQTINNDHPQKSCGAQPTTDEKY

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(439-528)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 77111..123302

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VJF75_RS00440 74830..77130 - 2301 WP_029392471 F-type conjugative transfer protein TrbC -
VJF75_RS00445 77111..78229 - 1119 WP_029391999 DsbC family protein trbB
VJF75_RS00450 78226..79560 - 1335 WP_172440316 IncI1-type conjugal transfer protein TrbA trbA
VJF75_RS00455 79871..79954 + 84 WP_271298668 DinQ-like type I toxin DqlB -
VJF75_RS00460 80017..80193 - 177 WP_032172741 hypothetical protein -
VJF75_RS00465 80344..80811 - 468 WP_000598962 thermonuclease family protein -
VJF75_RS00470 80971..81594 + 624 WP_001155252 helix-turn-helix domain-containing protein -
VJF75_RS00475 81792..82007 - 216 WP_000266543 hypothetical protein -
VJF75_RS00480 82011..82379 - 369 WP_029391948 hypothetical protein -
VJF75_RS00485 82678..82920 - 243 WP_029391947 hypothetical protein -
VJF75_RS00490 83249..83401 + 153 WP_021532728 Hok/Gef family protein -
VJF75_RS00495 83715..83846 - 132 Protein_98 ethanolamine utilization protein EutE -
VJF75_RS00500 83941..84150 + 210 WP_000062946 HEAT repeat domain-containing protein -
VJF75_RS00505 84215..84868 - 654 WP_029391946 plasmid IncI1-type surface exclusion protein ExcA -
VJF75_RS00510 84956..87121 - 2166 WP_029391945 DotA/TraY family protein traY
VJF75_RS00515 87194..87763 - 570 WP_000650755 conjugal transfer protein TraX -
VJF75_RS00520 87760..88965 - 1206 WP_029391944 conjugal transfer protein TraW traW
VJF75_RS00525 88926..89543 - 618 WP_029391943 hypothetical protein traV
VJF75_RS00530 89543..92587 - 3045 WP_029391942 conjugal transfer protein traU
VJF75_RS00535 92763..93143 - 381 WP_000690886 hypothetical protein -
VJF75_RS00540 93143..93451 - 309 WP_029391941 hypothetical protein -
VJF75_RS00545 93647..93964 + 318 WP_000118520 quaternary ammonium compound efflux SMR transporter SugE -
VJF75_RS00550 93961..94494 - 534 WP_001221666 lipocalin family protein -
VJF75_RS00555 94588..95733 - 1146 WP_000976514 extended-spectrum class C beta-lactamase CMY-2 -
VJF75_RS00560 96057..97319 - 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
VJF75_RS00565 97656..98474 - 819 WP_072132149 conjugal transfer protein TraT traT
VJF75_RS00570 98389..98640 - 252 WP_021532719 hypothetical protein -
VJF75_RS00575 98697..99095 - 399 WP_029391936 DUF6750 family protein traR
VJF75_RS00580 99142..99672 - 531 WP_000987022 conjugal transfer protein TraQ traQ
VJF75_RS00585 99669..100382 - 714 WP_021532717 conjugal transfer protein TraP traP
VJF75_RS00590 100379..101710 - 1332 WP_323873455 conjugal transfer protein TraO traO
VJF75_RS00595 101714..102688 - 975 WP_029391933 DotH/IcmK family type IV secretion protein traN
VJF75_RS00600 102699..103394 - 696 WP_029391932 DotI/IcmL family type IV secretion protein traM
VJF75_RS00605 103406..103756 - 351 WP_021532713 hypothetical protein traL
VJF75_RS00610 103773..107834 - 4062 WP_029391931 LPD7 domain-containing protein -
VJF75_RS00615 107898..108188 - 291 WP_000817799 hypothetical protein traK
VJF75_RS00620 108185..109333 - 1149 WP_000625247 plasmid transfer ATPase TraJ virB11
VJF75_RS00625 109317..110153 - 837 WP_029391930 type IV secretory system conjugative DNA transfer family protein traI
VJF75_RS00630 110150..110602 - 453 WP_001081199 DotD/TraH family lipoprotein -
VJF75_RS00635 110840..110971 + 132 WP_257792844 hypothetical protein -
VJF75_RS00640 110961..112163 - 1203 WP_029391929 conjugal transfer protein TraF -
VJF75_RS00645 112253..113074 - 822 WP_000804089 hypothetical protein traE
VJF75_RS00650 113325..113870 - 546 WP_029391928 hypothetical protein -
VJF75_RS00655 113989..114270 - 282 WP_029391927 hypothetical protein -
VJF75_RS00660 114311..115480 - 1170 WP_029391926 site-specific integrase -
VJF75_RS00665 116409..116768 - 360 WP_227854476 shufflon protein B -
VJF75_RS00670 117190..117528 + 339 WP_072106734 prepilin, shufflon protein A -
VJF75_RS00675 117533..118906 - 1374 WP_115747255 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
VJF75_RS00680 118903..119610 - 708 WP_202110611 A24 family peptidase -
VJF75_RS00685 119570..120046 - 477 WP_029391914 lytic transglycosylase domain-containing protein virB1
VJF75_RS00690 120105..120641 - 537 WP_029391915 type 4 pilus major pilin -
VJF75_RS00695 120692..121792 - 1101 WP_029391916 type II secretion system F family protein -
VJF75_RS00700 121794..123302 - 1509 WP_021532701 GspE/PulE family protein virB11
VJF75_RS00705 123399..123995 - 597 WP_029391917 hypothetical protein -
VJF75_RS00710 124091..124645 - 555 WP_021532699 hypothetical protein -
VJF75_RS00715 124694..125146 - 453 WP_029391918 type IV pilus biogenesis protein PilP -
VJF75_RS00720 125136..126431 - 1296 WP_021532697 type 4b pilus protein PilO2 -
VJF75_RS00725 126452..128071 - 1620 WP_021532696 PilN family type IVB pilus formation outer membrane protein -

Host bacterium

ID   20060 GenBank   NZ_CP141234
Plasmid name   SB18003|unnamed Incompatibility group   IncB/O/K/Z
Plasmid size   133303 bp Coordinate of oriT [Strand]   71452..71524 [-]
Host baterium   Escherichia sp. SB18003

Cargo genes

Drug resistance gene   tet(A), dfrA1, blaTEM-1B, sul2, blaCMY-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -