Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   119621
Name   oriT_SB18001|unnamed in_silico
Organism   Escherichia sp. SB18001
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP141236 (70705..70777 [-], 73 nt)
oriT length   73 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 73 nt

>oriT_SB18001|unnamed
GTCGGGGCAAAGCCCTGACCAGGTGGGGAATGTCTGAGTGCGCGTGCGCGGTCCGACATTCCCACATCCTGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   12398 GenBank   WP_029391987
Name   Relaxase_VJF92_RS00435_SB18001|unnamed insolico UniProt ID   A0A2H5C199
Length   906 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 906 a.a.        Molecular weight: 105112.51 Da        Isoelectric Point: 8.2682

>WP_029391987.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterobacteriaceae]
MNAIIPHKRRDGRSSFEDLIAYTSVRDDVQENELTEDSEIKSDVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCNSLETAAEEMQYKADKAVFSRNDTDPVFHYILSWPAHESPRPEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINWLSWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRHFAERLPEMARNGELESCLDVHRTLAKAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLMT
LDYMQDLDGGWQPVPKDIFTQVIPGERFRGHSIGTQAVSDYEWYRMRMGTGPQGAIKRELFSDKESLWGY
ALIQCRSQIEEMIAGGDFSWQACHEMFARKGLMLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEP
QAGPFEIAGADIFERVKPECRYNPELAASDEVEPGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRK
PDLRYGERLREIHAACRRRKAYIRVQFRDPQVRKLHYHIAEVQRMQALIRLKESVKEERLSLIAEGKWYP
LSYRQWVEQQAAQGDRAAVSQLRGWDYRDRRSRNKDKRRTTNADRCVVLCEPGGTPLFNNVAKLEARLQK
NGSVHFRDTRTGKNVCTDYGDRVVFYHHTDRNELAEKLDLIAPVLFSRNGKLGFEPEGSYQQFNDVFAEM
VAWHNAAGITGNGHFTITRPDVDLHRQRSEQYYREYIRQQTRLSESHDDNYTLRQEKTWEPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure


Source ID Structure
AlphaFold DB A0A2H5C199


Auxiliary protein

ID   7054 GenBank   WP_001291058
Name   WP_001291058_SB18001|unnamed insolico UniProt ID   A0A7I0L241
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12730.52 Da        Isoelectric Point: 9.9656

>WP_001291058.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRTGSENRKRIVKFTARFTEDEAEIVREKAESSGQTVSTFIRSSSLDKVVNCRTDDRMIDEIMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITEYVNALRRDLMGR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L241


T4CP

ID   14556 GenBank   WP_029392471
Name   trbC_VJF92_RS00440_SB18001|unnamed insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 87239.20 Da        Isoelectric Point: 6.6676

>WP_029392471.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSQHHVNPDLIHRTAWGNPLWNALHNLNIIGLCLAGSIITALIWPLALPVCLLFTLVTSVIFTLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETSPARGIFYVGYRRINDIGRELWLSMDDLTRHII
FFSTTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTTRTIWYLSRRFGREDDIEVINFMNGGKSRSEI
IQSGEKSRPQSNTWNPFAFSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVRERKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFITQQSMILARDLGYRLE
GTDAQTLEVKKYKGRFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMMAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGLMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYIAIEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTEKTSRKRRKKHTEPYRIIDTFQDQLKRTQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEILLPVAENNKSQTINNDHPQKSCGAQPTTDEKY

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(439-528)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 76364..122528

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VJF92_RS00440 74083..76383 - 2301 WP_029392471 F-type conjugative transfer protein TrbC -
VJF92_RS00445 76364..77482 - 1119 WP_029391999 DsbC family protein trbB
VJF92_RS00450 77479..78786 - 1308 WP_063269898 IncI1-type conjugal transfer protein TrbA trbA
VJF92_RS00455 79097..79180 + 84 WP_271298668 DinQ-like type I toxin DqlB -
VJF92_RS00460 79243..79419 - 177 WP_032172741 hypothetical protein -
VJF92_RS00465 79570..80037 - 468 WP_000598962 thermonuclease family protein -
VJF92_RS00470 80197..80820 + 624 WP_001155252 helix-turn-helix domain-containing protein -
VJF92_RS00475 81018..81233 - 216 WP_000266543 hypothetical protein -
VJF92_RS00480 81237..81605 - 369 WP_029391948 hypothetical protein -
VJF92_RS00485 81904..82146 - 243 WP_029391947 hypothetical protein -
VJF92_RS00490 82475..82627 + 153 WP_021532728 Hok/Gef family protein -
VJF92_RS00495 82941..83072 - 132 Protein_98 ethanolamine utilization protein EutE -
VJF92_RS00500 83209..83376 + 168 WP_074443024 HEAT repeat domain-containing protein -
VJF92_RS00505 83441..84094 - 654 WP_029391946 plasmid IncI1-type surface exclusion protein ExcA -
VJF92_RS00510 84182..86347 - 2166 WP_029391945 DotA/TraY family protein traY
VJF92_RS00515 86420..86989 - 570 WP_000650755 conjugal transfer protein TraX -
VJF92_RS00520 86986..88191 - 1206 WP_029391944 conjugal transfer protein TraW traW
VJF92_RS00525 88152..88769 - 618 WP_029391943 hypothetical protein traV
VJF92_RS00530 88769..91813 - 3045 WP_029391942 conjugal transfer protein traU
VJF92_RS00535 91989..92369 - 381 WP_000690886 hypothetical protein -
VJF92_RS00540 92369..92677 - 309 WP_029391941 hypothetical protein -
VJF92_RS00545 92873..93190 + 318 WP_000118520 quaternary ammonium compound efflux SMR transporter SugE -
VJF92_RS00550 93187..93720 - 534 WP_001221666 lipocalin family protein -
VJF92_RS00555 93814..94959 - 1146 WP_000976514 extended-spectrum class C beta-lactamase CMY-2 -
VJF92_RS00560 95283..96545 - 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
VJF92_RS00565 96882..97700 - 819 WP_072132149 conjugal transfer protein TraT traT
VJF92_RS00570 97615..97866 - 252 WP_021532719 hypothetical protein -
VJF92_RS00575 97923..98321 - 399 WP_029391936 DUF6750 family protein traR
VJF92_RS00580 98368..98898 - 531 WP_000987022 conjugal transfer protein TraQ traQ
VJF92_RS00585 98895..99608 - 714 WP_021532717 conjugal transfer protein TraP traP
VJF92_RS00590 99605..100936 - 1332 WP_323873455 conjugal transfer protein TraO traO
VJF92_RS00595 100940..101914 - 975 WP_029391933 DotH/IcmK family type IV secretion protein traN
VJF92_RS00600 101925..102620 - 696 WP_029391932 DotI/IcmL family type IV secretion protein traM
VJF92_RS00605 102632..102982 - 351 WP_021532713 hypothetical protein traL
VJF92_RS00610 102999..107060 - 4062 WP_029391931 LPD7 domain-containing protein -
VJF92_RS00615 107124..107414 - 291 WP_000817799 hypothetical protein traK
VJF92_RS00620 107411..108559 - 1149 WP_000625247 plasmid transfer ATPase TraJ virB11
VJF92_RS00625 108543..109379 - 837 WP_029391930 type IV secretory system conjugative DNA transfer family protein traI
VJF92_RS00630 109376..109828 - 453 WP_001081199 DotD/TraH family lipoprotein -
VJF92_RS00635 110066..110197 + 132 WP_257792844 hypothetical protein -
VJF92_RS00640 110187..111389 - 1203 WP_029391929 conjugal transfer protein TraF -
VJF92_RS00645 111479..112300 - 822 WP_000804089 hypothetical protein traE
VJF92_RS00650 112551..113096 - 546 WP_029391928 hypothetical protein -
VJF92_RS00655 113215..113496 - 282 WP_029391927 hypothetical protein -
VJF92_RS00660 113537..114706 - 1170 WP_029391926 site-specific integrase -
VJF92_RS00665 115149..115697 + 549 WP_242647287 prepilin, shufflon protein A -
VJF92_RS00670 115702..116101 - 400 Protein_133 phage tail protein -
VJF92_RS00675 116888..118132 - 1245 WP_119799357 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
VJF92_RS00680 118129..118836 - 708 WP_202110611 A24 family peptidase -
VJF92_RS00685 118796..119272 - 477 WP_029391914 lytic transglycosylase domain-containing protein virB1
VJF92_RS00690 119331..119867 - 537 WP_029391915 type 4 pilus major pilin -
VJF92_RS00695 119918..121018 - 1101 WP_029391916 type II secretion system F family protein -
VJF92_RS00700 121020..122528 - 1509 WP_021532701 GspE/PulE family protein virB11
VJF92_RS00705 122625..123221 - 597 WP_029391917 hypothetical protein -
VJF92_RS00710 123317..123871 - 555 WP_021532699 hypothetical protein -
VJF92_RS00715 123920..124372 - 453 WP_029391918 type IV pilus biogenesis protein PilP -
VJF92_RS00720 124362..125657 - 1296 WP_021532697 type 4b pilus protein PilO2 -
VJF92_RS00725 125678..127297 - 1620 WP_021532696 PilN family type IVB pilus formation outer membrane protein -

Host bacterium

ID   20051 GenBank   NZ_CP141236
Plasmid name   SB18001|unnamed Incompatibility group   IncB/O/K/Z
Plasmid size   132529 bp Coordinate of oriT [Strand]   70705..70777 [-]
Host baterium   Escherichia sp. SB18001

Cargo genes

Drug resistance gene   tet(A), dfrA1, blaTEM-1B, sul2, blaCMY-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -