Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 119502 |
| Name | oriT_pCRENT-301_1  |
| Organism | Klebsiella aerogenes |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_KY657477 (59730..59782 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pCRENT-301_1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 14464 | GenBank | WP_015059539 |
| Name | t4cp2_HTM26_RS00115_pCRENT-301_1 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 12604..36061
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTM26_RS00050 | 8506..8661 | - | 156 | WP_001358489 | hypothetical protein | - |
| HTM26_RS00055 | 8670..9041 | + | 372 | WP_172690083 | pilus assembly protein | - |
| HTM26_RS00060 | 9726..10886 | - | 1161 | WP_228717763 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTM26_RS00065 | 10899..11249 | - | 351 | WP_267313017 | prepilin peptidase | - |
| HTM26_RS00070 | 11333..12301 | - | 969 | WP_000654812 | IS5-like element IS903B family transposase | - |
| HTM26_RS00075 | 12604..13086 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| HTM26_RS00080 | 13152..13709 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| HTM26_RS00085 | 13754..14863 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| HTM26_RS00090 | 14854..16392 | - | 1539 | WP_000466225 | GspE/PulE family protein | virB11 |
| HTM26_RS00095 | 16417..16911 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| HTM26_RS00100 | 16895..18217 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| HTM26_RS00105 | 18256..19899 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| HTM26_RS00110 | 19892..20428 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| HTM26_RS00115 | 20475..22433 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| HTM26_RS00120 | 22449..23504 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| HTM26_RS00125 | 23523..24662 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| HTM26_RS00130 | 24652..25353 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
| HTM26_RS00135 | 25419..26153 | - | 735 | WP_000432282 | virB8 family protein | virB8 |
| HTM26_RS00140 | 26319..28676 | - | 2358 | WP_181367171 | VirB4 family type IV secretion system protein | virb4 |
| HTM26_RS00145 | 28682..29002 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| HTM26_RS00430 | 29073..29363 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| HTM26_RS00155 | 29363..29947 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| HTM26_RS00160 | 29968..30366 | - | 399 | WP_072643816 | hypothetical protein | - |
| HTM26_RS00165 | 30485..30922 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| HTM26_RS00170 | 30928..32163 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| HTM26_RS00175 | 32166..32465 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| HTM26_RS00180 | 32533..32814 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HTM26_RS00185 | 32804..33055 | - | 252 | WP_000121741 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| HTM26_RS00190 | 33155..33790 | - | 636 | WP_015059536 | hypothetical protein | - |
| HTM26_RS00195 | 33863..34150 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| HTM26_RS00200 | 34163..34417 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| HTM26_RS00205 | 34419..35060 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| HTM26_RS00210 | 35066..36061 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| HTM26_RS00215 | 36065..36322 | - | 258 | WP_000739144 | hypothetical protein | - |
| HTM26_RS00220 | 36319..36672 | - | 354 | WP_223286767 | hypothetical protein | - |
| HTM26_RS00225 | 36892..37338 | - | 447 | WP_001243165 | hypothetical protein | - |
| HTM26_RS00230 | 37349..37519 | - | 171 | WP_000550720 | hypothetical protein | - |
| HTM26_RS00235 | 37523..37966 | - | 444 | WP_000964330 | NfeD family protein | - |
| HTM26_RS00240 | 38340..39293 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| HTM26_RS00245 | 39320..39496 | - | 177 | WP_000753050 | hypothetical protein | - |
| HTM26_RS00250 | 39489..39704 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| HTM26_RS00255 | 39697..40203 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 19932 | GenBank | NZ_KY657477 |
| Plasmid name | pCRENT-301_1 | Incompatibility group | IncI2 |
| Plasmid size | 67073 bp | Coordinate of oriT [Strand] | 59730..59782 [-] |
| Host baterium | Klebsiella aerogenes |
Cargo genes
| Drug resistance gene | blaCTX-M-55, mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |