Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   119229
Name   oriT_pWLK-107717 in_silico
Organism   Raoultella ornithinolytica strain WLK218
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP038276 (3095..3144 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..13, 18..24  (GCAAAAT..ATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pWLK-107717
AAATCTGCAAAATATTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   14250 GenBank   WP_075606915
Name   traD_E4K08_RS01145_pWLK-107717 insolico UniProt ID   _
Length   772 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 772 a.a.        Molecular weight: 86712.47 Da        Isoelectric Point: 5.0825

>WP_075606915.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFIIFWVLCGLILMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTINYYGKSLEYNSEQILADKYTIWCGEQLWTSFVFAAIVSLTVCIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKHSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDIWRECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFSEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLKNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLGMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKSRPKIAEGFILRNLDTRTDARLDTLLEAREAESSHARTLFTPDAPAPELAEKDEKVGNPPEQSQPAE
SSGTPATVKVPSTAKTPEADESGQSPEVSNPAALLTKVVTVPLTRPRPAAATGTAAVASATDVRATPAGG
TEQALETQPAEQGQDMLPPGVNEYGEIDDMHAWDEWQSGEQTQRDMQRREEVNINHSHRRDEQDDIEIGG
NF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 82143..107346

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4K08_RS01145 (E4K08_01145) 82143..84461 - 2319 WP_075606915 type IV conjugative transfer system coupling protein TraD virb4
E4K08_RS30915 84580..85272 - 693 WP_202395549 hypothetical protein -
E4K08_RS01155 (E4K08_01155) 85518..86189 - 672 WP_088883382 hypothetical protein -
E4K08_RS01160 (E4K08_01160) 86206..89061 - 2856 WP_075606917 conjugal transfer mating-pair stabilization protein TraG traG
E4K08_RS01165 (E4K08_01165) 89061..90431 - 1371 WP_075606918 conjugal transfer pilus assembly protein TraH traH
E4K08_RS01170 (E4K08_01170) 90418..90978 - 561 WP_039698500 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
E4K08_RS01175 (E4K08_01175) 90953..91189 - 237 WP_053390221 type-F conjugative transfer system pilin chaperone TraQ -
E4K08_RS01180 (E4K08_01180) 91200..91952 - 753 WP_053390220 type-F conjugative transfer system pilin assembly protein TraF traF
E4K08_RS01185 (E4K08_01185) 91973..92299 - 327 WP_053390219 hypothetical protein -
E4K08_RS01190 (E4K08_01190) 92345..92587 - 243 WP_053390218 conjugal transfer protein TrbE -
E4K08_RS01195 (E4K08_01195) 92577..93188 - 612 WP_053390217 hypothetical protein -
E4K08_RS01200 (E4K08_01200) 93181..93441 - 261 WP_053390216 hypothetical protein -
E4K08_RS01205 (E4K08_01205) 93473..95428 - 1956 WP_064359956 type-F conjugative transfer system mating-pair stabilization protein TraN traN
E4K08_RS01210 (E4K08_01210) 95425..95808 - 384 WP_053390297 hypothetical protein -
E4K08_RS01215 (E4K08_01215) 95805..96452 - 648 WP_064343536 type-F conjugative transfer system pilin assembly protein TrbC trbC
E4K08_RS01220 (E4K08_01220) 96465..97424 - 960 WP_229295972 conjugal transfer pilus assembly protein TraU traU
E4K08_RS01225 (E4K08_01225) 97468..98094 - 627 WP_064343535 type-F conjugative transfer system protein TraW traW
E4K08_RS01230 (E4K08_01230) 98091..98483 - 393 WP_064343534 type-F conjugative transfer system protein TrbI -
E4K08_RS01235 (E4K08_01235) 98483..101122 - 2640 WP_137055848 type IV secretion system protein TraC virb4
E4K08_RS01240 (E4K08_01240) 101215..101598 - 384 WP_042946290 hypothetical protein -
E4K08_RS01245 (E4K08_01245) 101686..101985 - 300 WP_032736863 hypothetical protein -
E4K08_RS30920 101982..102383 - 402 WP_064343532 hypothetical protein -
E4K08_RS01255 (E4K08_01255) 102467..102655 - 189 WP_053390286 hypothetical protein -
E4K08_RS01260 (E4K08_01260) 103268..103852 - 585 WP_064343530 type IV conjugative transfer system lipoprotein TraV traV
E4K08_RS01265 (E4K08_01265) 103886..104320 - 435 WP_020322358 conjugal transfer protein TraP -
E4K08_RS01270 (E4K08_01270) 104313..105734 - 1422 WP_137055849 F-type conjugal transfer pilus assembly protein TraB traB
E4K08_RS01275 (E4K08_01275) 105734..106468 - 735 WP_032736867 type-F conjugative transfer system secretin TraK traK
E4K08_RS01280 (E4K08_01280) 106455..107021 - 567 WP_032736869 type IV conjugative transfer system protein TraE traE
E4K08_RS01285 (E4K08_01285) 107041..107346 - 306 WP_032736870 type IV conjugative transfer system protein TraL traL

Host bacterium

ID   19659 GenBank   NZ_CP038276
Plasmid name   pWLK-107717 Incompatibility group   IncFIB
Plasmid size   107717 bp Coordinate of oriT [Strand]   3095..3144 [+]
Host baterium   Raoultella ornithinolytica strain WLK218

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   arsH, arsC, arsB, arsA, arsD, arsR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -