Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   119211
Name   oriT_pKMISG1 in_silico
Organism   Klebsiella michiganensis strain KMISG1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CM011641 (100977..101026 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pKMISG1
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   14238 GenBank   WP_032495268
Name   traD_DZK29_RS00155_pKMISG1 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85986.98 Da        Isoelectric Point: 5.0632

>WP_032495268.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKITEGFIPRRLDTRVDARLSALLEAREAEGSLARALFTPDTPEPGPADTDSHASEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1163..26784

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DZK29_RS00005 (DZK29_29795) 148..1128 - 981 WP_000019473 IS5-like element ISKpn26 family transposase -
DZK29_RS00010 (DZK29_29800) 1163..1744 + 582 WP_040180858 type IV conjugative transfer system protein TraE traE
DZK29_RS00015 (DZK29_29805) 1731..2471 + 741 WP_004152497 type-F conjugative transfer system secretin TraK traK
DZK29_RS00020 (DZK29_29810) 2471..3895 + 1425 WP_004155033 F-type conjugal transfer pilus assembly protein TraB traB
DZK29_RS00025 (DZK29_29815) 4009..4593 + 585 WP_004161368 type IV conjugative transfer system lipoprotein TraV traV
DZK29_RS00030 (DZK29_29820) 4725..5135 + 411 WP_004152499 hypothetical protein -
DZK29_RS00035 (DZK29_29825) 5241..5459 + 219 WP_004152501 hypothetical protein -
DZK29_RS00040 (DZK29_29830) 5460..5771 + 312 WP_004152502 hypothetical protein -
DZK29_RS00045 (DZK29_29835) 5838..6242 + 405 WP_004152503 hypothetical protein -
DZK29_RS00050 (DZK29_29840) 6285..6674 + 390 WP_004153076 hypothetical protein -
DZK29_RS00055 (DZK29_29845) 6682..7080 + 399 WP_011977783 hypothetical protein -
DZK29_RS00060 (DZK29_29850) 7152..9791 + 2640 WP_004152505 type IV secretion system protein TraC virb4
DZK29_RS00065 (DZK29_29855) 9791..10180 + 390 WP_004152506 type-F conjugative transfer system protein TrbI -
DZK29_RS00070 (DZK29_29860) 10180..10806 + 627 WP_004152507 type-F conjugative transfer system protein TraW traW
DZK29_RS00075 (DZK29_29865) 10848..11237 + 390 WP_004152508 hypothetical protein -
DZK29_RS00080 (DZK29_29870) 11234..12223 + 990 WP_011977785 conjugal transfer pilus assembly protein TraU traU
DZK29_RS00085 (DZK29_29875) 12236..12874 + 639 WP_004152672 type-F conjugative transfer system pilin assembly protein TrbC trbC
DZK29_RS00090 (DZK29_29880) 12933..14888 + 1956 WP_004152673 type-F conjugative transfer system mating-pair stabilization protein TraN traN
DZK29_RS00095 (DZK29_29885) 14920..15174 + 255 WP_004152674 conjugal transfer protein TrbE -
DZK29_RS00100 (DZK29_29890) 15152..15400 + 249 WP_004152675 hypothetical protein -
DZK29_RS00105 (DZK29_29895) 15413..15739 + 327 WP_004152676 hypothetical protein -
DZK29_RS00110 (DZK29_29900) 15760..16512 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
DZK29_RS00115 (DZK29_29905) 16523..16762 + 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
DZK29_RS00120 (DZK29_29910) 16734..17291 + 558 WP_004152678 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
DZK29_RS00125 (DZK29_29915) 17337..17780 + 444 WP_004152679 F-type conjugal transfer protein TrbF -
DZK29_RS00130 (DZK29_29920) 17758..19137 + 1380 WP_004165169 conjugal transfer pilus assembly protein TraH traH
DZK29_RS00135 (DZK29_29925) 19137..21986 + 2850 WP_004152624 conjugal transfer mating-pair stabilization protein TraG traG
DZK29_RS00140 (DZK29_29930) 21999..22547 + 549 WP_004152623 conjugal transfer entry exclusion protein TraS -
DZK29_RS00145 (DZK29_29935) 22731..23462 + 732 WP_004152622 conjugal transfer complement resistance protein TraT -
DZK29_RS30310 23654..24343 + 690 WP_004198206 hypothetical protein -
DZK29_RS00155 (DZK29_29945) 24472..26784 + 2313 WP_032495268 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   19641 GenBank   NZ_CM011641
Plasmid name   pKMISG1 Incompatibility group   IncFII
Plasmid size   103163 bp Coordinate of oriT [Strand]   100977..101026 [-]
Host baterium   Klebsiella michiganensis strain KMISG1

Cargo genes

Drug resistance gene   blaKPC-3
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9