Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   119170
Name   oriT_FDAARGOS_64|unnamed2 in_silico
Organism   Raoultella planticola strain FDAARGOS_64
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP026049 (17363..17412 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_FDAARGOS_64|unnamed2
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   6936 GenBank   WP_032700831
Name   WP_032700831_FDAARGOS_64|unnamed2 insolico UniProt ID   A0A485D480
Length   129 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 129 a.a.        Molecular weight: 14705.63 Da        Isoelectric Point: 4.4711

>WP_032700831.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Klebsiella/Raoultella group]
MARVQAYASDEVAEKINAIVEKRKAEGAKDKDVSFSSVASMLLELGLRVYEAQMERKESGFNQAEFNKML
LENVIKTQFSISKVLAMESLSPHIQGDERFDFKSMVMNIRDDAKEVVERFFPDTDDEES

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A485D480


T4CP

ID   14200 GenBank   WP_040118437
Name   traD_MC50_RS28370_FDAARGOS_64|unnamed2 insolico UniProt ID   _
Length   776 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 776 a.a.        Molecular weight: 86788.85 Da        Isoelectric Point: 4.9734

>WP_040118437.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella/Raoultella group]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFIIFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTINYYGRSLEYNAEQILADKYTIWCGEQLWTSFVLAAVVSLVICIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILLNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLSLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFATGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRSLDTRVDTRLSALLEAREAEGSLARALFTPDAPAPDPAEKDVKVGNTPEQSQPAE
SIESPATVKVPATAKTPAADEIGQSPETPEPAAPVTKVVTVPLIRPRSATATGTAAVATTAASTTSATTV
PAGGTEQELAQQPTEQGQDRLPAGMNDDGVIEDMDAYDAWLAGEQTQRDMQRREEVNINHSHRRDEQDDI
EIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 812..17965

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MC50_RS27265 (MC50_027265) 812..2767 - 1956 WP_040118411 type-F conjugative transfer system mating-pair stabilization protein TraN traN
MC50_RS27270 (MC50_027270) 2767..3396 - 630 WP_032700817 type-F conjugative transfer system pilin assembly protein TrbC trbC
MC50_RS27275 (MC50_027275) 3409..4368 - 960 WP_032716690 conjugal transfer pilus assembly protein TraU traU
MC50_RS27280 (MC50_027280) 4409..5038 - 630 WP_032716660 type-F conjugative transfer system protein TraW traW
MC50_RS27285 (MC50_027285) 5035..5427 - 393 WP_032716659 type-F conjugative transfer system protein TrbI -
MC50_RS27290 (MC50_027290) 5427..8066 - 2640 WP_032716658 type IV secretion system protein TraC virb4
MC50_RS27295 (MC50_027295) 8146..8535 - 390 WP_040118412 hypothetical protein -
MC50_RS27305 (MC50_027305) 8912..9316 - 405 WP_040118414 hypothetical protein -
MC50_RS27310 (MC50_027310) 9313..9534 - 222 WP_032732073 hypothetical protein -
MC50_RS29005 10016..10495 - 480 WP_223306708 hypothetical protein -
MC50_RS27325 (MC50_027325) 10602..11171 - 570 WP_071889124 type IV conjugative transfer system lipoprotein TraV traV
MC50_RS27330 (MC50_027330) 11190..11396 - 207 WP_032700826 hypothetical protein -
MC50_RS27335 (MC50_027335) 11377..11973 - 597 WP_119834738 conjugal transfer protein TraP -
MC50_RS27340 (MC50_027340) 11966..13384 - 1419 WP_040118415 F-type conjugal transfer pilus assembly protein TraB traB
MC50_RS27345 (MC50_027345) 13384..14118 - 735 WP_040118416 type-F conjugative transfer system secretin TraK traK
MC50_RS27350 (MC50_027350) 14105..14671 - 567 WP_040118417 type IV conjugative transfer system protein TraE traE
MC50_RS27355 (MC50_027355) 14691..14996 - 306 WP_020323523 type IV conjugative transfer system protein TraL traL
MC50_RS27360 (MC50_027360) 15010..15378 - 369 WP_047665734 type IV conjugative transfer system pilin TraA -
MC50_RS27365 (MC50_027365) 15440..15604 - 165 WP_032444506 TraY domain-containing protein -
MC50_RS27370 (MC50_027370) 15782..16471 - 690 WP_071889125 hypothetical protein -
MC50_RS27375 (MC50_027375) 16672..17061 - 390 WP_032700831 conjugal transfer relaxosome DNA-binding protein TraM -
MC50_RS27380 (MC50_027380) 17486..17965 + 480 WP_032716648 transglycosylase SLT domain-containing protein virB1
MC50_RS27385 (MC50_027385) 18003..18533 - 531 WP_032716647 antirestriction protein -
MC50_RS27390 (MC50_027390) 19218..19364 - 147 WP_032700834 hypothetical protein -
MC50_RS27395 (MC50_027395) 19458..19805 - 348 WP_047665736 hypothetical protein -
MC50_RS27400 (MC50_027400) 19831..19989 - 159 WP_162180130 hypothetical protein -
MC50_RS27405 (MC50_027405) 20046..20321 - 276 WP_032700867 hypothetical protein -
MC50_RS27420 (MC50_027420) 21140..21421 - 282 WP_004118961 helix-turn-helix transcriptional regulator -
MC50_RS27425 (MC50_027425) 21402..21731 - 330 WP_004118963 type II toxin-antitoxin system RelE/ParE family toxin -
MC50_RS29010 22051..22138 - 88 Protein_30 theronine dehydrogenase -
MC50_RS27435 (MC50_027435) 22135..22863 - 729 WP_004118966 plasmid SOS inhibition protein A -

Host bacterium

ID   19600 GenBank   NZ_CP026049
Plasmid name   FDAARGOS_64|unnamed2 Incompatibility group   IncFIB
Plasmid size   206855 bp Coordinate of oriT [Strand]   17363..17412 [+]
Host baterium   Raoultella planticola strain FDAARGOS_64

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsR, arsD, arsA, arsB, arsC, arsH
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -