Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   118961
Name   oriT_pMl1 in_silico
Organism   Sinorhizobium medicae strain ml49
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP140898 (116043..116099 [+], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAG..CTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCCCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pMl1
GCAGGAAAGTGGCGTAGCACATCTTTCCGTATCCTGCCCCTCCGAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   14076 GenBank   WP_208180198
Name   t4cp2_U8C36_RS35710_pMl1 insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77679.50 Da        Isoelectric Point: 9.5372

>WP_208180198.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium medicae]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILEATITSNPFAPIQQFWHYKTSPALQKVALGS
MVPALLVACLVAYIGLKPTSNPLGDAAFQDIASLRRVKWFRKQGHIFGRMGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGVISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMNKLPYVAGYNIKLAFIVQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQVNIPQVPEVDYLSPKPVPATTP
EYAKGGDPSVEIPSPAPAAEEKPLTAAAAEAAPVKAEPAADEKAAAPAKRTVNKKALRPKSKPTAANTGG
AEASASLDAMEARIRAIEEGLKPKAAQLKEVVETIAEKLGDKSSTTRRNVTEIFNATVPDPAEVGVAAE

  Protein domains


Predicted by InterproScan.

(122-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 91862..101785

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
U8C36_RS35615 (U8C36_35620) 87077..87367 + 291 WP_234942436 hypothetical protein -
U8C36_RS35620 (U8C36_35625) 87447..87863 - 417 WP_208180186 hypothetical protein -
U8C36_RS35625 (U8C36_35630) 87883..88473 - 591 WP_208180187 hypothetical protein -
U8C36_RS35630 (U8C36_35635) 88475..88879 - 405 WP_208180188 hypothetical protein -
U8C36_RS35635 (U8C36_35640) 88880..89581 - 702 WP_208180189 thermonuclease family protein -
U8C36_RS35640 (U8C36_35645) 89578..90114 - 537 WP_208180190 thermonuclease family protein -
U8C36_RS35645 (U8C36_35650) 90111..90719 - 609 WP_208180191 hypothetical protein -
U8C36_RS35650 (U8C36_35655) 90942..91850 + 909 WP_208180225 lytic transglycosylase domain-containing protein -
U8C36_RS35655 (U8C36_35660) 91862..92200 + 339 WP_208180192 TrbC/VirB2 family protein virB2
U8C36_RS35660 (U8C36_35665) 92204..92503 + 300 WP_014531077 type IV secretion system protein VirB3 virB3
U8C36_RS35665 (U8C36_35670) 92506..94965 + 2460 WP_208180193 VirB4 family type IV secretion system protein virb4
U8C36_RS35670 (U8C36_35675) 94962..96050 + 1089 WP_127515472 lytic transglycosylase domain-containing protein -
U8C36_RS35675 (U8C36_35680) 96062..96763 + 702 WP_128146496 type IV secretion system protein -
U8C36_RS35680 (U8C36_35685) 96753..96980 + 228 WP_128146487 hypothetical protein -
U8C36_RS35685 (U8C36_35690) 96996..98024 + 1029 WP_128146486 type IV secretion system protein virB6
U8C36_RS35690 (U8C36_35695) 98063..98758 + 696 WP_208180194 virB8 family protein virB8
U8C36_RS35695 (U8C36_35700) 98755..99564 + 810 WP_208180195 TrbG/VirB9 family P-type conjugative transfer protein virB9
U8C36_RS35700 (U8C36_35705) 99564..100776 + 1213 Protein_101 type IV secretion system protein VirB10 -
U8C36_RS35705 (U8C36_35710) 100757..101785 + 1029 WP_208180197 P-type DNA transfer ATPase VirB11 virB11
U8C36_RS35710 (U8C36_35715) 101782..103881 + 2100 WP_208180198 type IV secretory system conjugative DNA transfer family protein -
U8C36_RS35715 (U8C36_35720) 104402..106258 + 1857 WP_322887502 S8 family serine peptidase -


Host bacterium


ID   19393 GenBank   NZ_CP140898
Plasmid name   pMl1 Incompatibility group   -
Plasmid size   169780 bp Coordinate of oriT [Strand]   116043..116099 [+]
Host baterium   Sinorhizobium medicae strain ml49

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -