Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   118883
Name   oriT_P1954|p00004 in_silico
Organism   Klebsiella sp. P1954
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP073376 (4170..4293 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_P1954|p00004
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   14019 GenBank   WP_015059012
Name   traC_KB890_RS27220_P1954|p00004 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99393.22 Da        Isoelectric Point: 6.3465

>WP_015059012.1 MULTISPECIES: type IV secretion system protein TraC [Gammaproteobacteria]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKKQARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-446)

TraG P-loop domain (P-loop_TraG)

(467-771)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 3598..15252

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KB890_RS27125 (KB890_27125) 1..720 + 720 WP_001276217 plasmid SOS inhibition protein A -
KB890_RS27650 942..1091 + 150 Protein_2 plasmid maintenance protein Mok -
KB890_RS27130 (KB890_27130) 1033..1158 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
KB890_RS27135 (KB890_27135) 1477..1773 - 297 Protein_4 hypothetical protein -
KB890_RS27140 (KB890_27140) 2073..2369 + 297 WP_001272251 hypothetical protein -
KB890_RS27145 (KB890_27145) 2480..3301 + 822 WP_001234445 DUF932 domain-containing protein -
KB890_RS27150 (KB890_27150) 3598..4245 - 648 WP_015059008 transglycosylase SLT domain-containing protein virB1
KB890_RS27155 (KB890_27155) 4522..4905 + 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
KB890_RS27160 (KB890_27160) 5096..5782 + 687 WP_015059009 PAS domain-containing protein -
KB890_RS27165 (KB890_27165) 5876..6103 + 228 WP_001254386 conjugal transfer relaxosome protein TraY -
KB890_RS27170 (KB890_27170) 6137..6502 + 366 WP_021519752 type IV conjugative transfer system pilin TraA -
KB890_RS27175 (KB890_27175) 6517..6828 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
KB890_RS27180 (KB890_27180) 6850..7416 + 567 WP_000399794 type IV conjugative transfer system protein TraE traE
KB890_RS27185 (KB890_27185) 7403..8131 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
KB890_RS27190 (KB890_27190) 8131..9558 + 1428 WP_032297072 F-type conjugal transfer pilus assembly protein TraB traB
KB890_RS27195 (KB890_27195) 9548..10138 + 591 WP_000002778 conjugal transfer pilus-stabilizing protein TraP -
KB890_RS27200 (KB890_27200) 10125..10322 + 198 WP_001324648 conjugal transfer protein TrbD -
KB890_RS27205 (KB890_27205) 10334..10585 + 252 WP_001038341 conjugal transfer protein TrbG -
KB890_RS27210 (KB890_27210) 10582..11097 + 516 WP_000809902 type IV conjugative transfer system lipoprotein TraV traV
KB890_RS27215 (KB890_27215) 11232..11453 + 222 WP_001278692 conjugal transfer protein TraR -
KB890_RS27220 (KB890_27220) 11613..14240 + 2628 WP_015059012 type IV secretion system protein TraC virb4
KB890_RS27225 (KB890_27225) 14237..14623 + 387 WP_015059013 type-F conjugative transfer system protein TrbI -
KB890_RS27230 (KB890_27230) 14620..15252 + 633 WP_001203735 type-F conjugative transfer system protein TraW traW
KB890_RS27655 15249..15341 + 93 Protein_24 hypothetical protein -
KB890_RS27235 (KB890_27235) 15406..16110 + 705 WP_001067858 IS6-like element IS26 family transposase -
KB890_RS27240 (KB890_27240) 16453..17328 + 876 WP_015387340 extended-spectrum class A beta-lactamase CTX-M-55 -
KB890_RS27245 (KB890_27245) 17375..17851 - 477 WP_013023839 WbuC family cupin fold metalloprotein -
KB890_RS27250 (KB890_27250) 18110..18853 - 744 Protein_28 class A beta-lactamase -
KB890_RS27255 (KB890_27255) 18903..19607 - 705 WP_001067855 IS6-like element IS26 family transposase -

Host bacterium

ID   19315 GenBank   NZ_CP073376
Plasmid name   P1954|p00004 Incompatibility group   IncFII
Plasmid size   55826 bp Coordinate of oriT [Strand]   4170..4293 [+]
Host baterium   Klebsiella sp. P1954

Cargo genes

Drug resistance gene   blaCTX-M-55, blaTEM-1B, rmtB
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -