Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 118801 |
| Name | oriT_pSECR18-2341_KPC  |
| Organism | Klebsiella aerogenes strain 18-2341 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP049601 (111405..111453 [-], 49 nt) |
| oriT length | 49 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | 32..33 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_pSECR18-2341_KPC
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 13950 | GenBank | WP_040120372 |
| Name | traD_G7033_RS24925_pSECR18-2341_KPC |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85972.07 Da Isoelectric Point: 5.1806
>WP_040120372.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTNSHAGEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTNSHAGEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 2731..19553
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G7033_RS24835 (G7033_24835) | 2342..2731 | + | 390 | WP_020803372 | type-F conjugative transfer system protein TrbI | - |
| G7033_RS24840 (G7033_24840) | 2731..3366 | + | 636 | WP_020325113 | type-F conjugative transfer system protein TraW | traW |
| G7033_RS24845 (G7033_24845) | 3401..3802 | + | 402 | WP_004194979 | hypothetical protein | - |
| G7033_RS24850 (G7033_24850) | 3799..4788 | + | 990 | WP_029497420 | conjugal transfer pilus assembly protein TraU | traU |
| G7033_RS24855 (G7033_24855) | 4801..5439 | + | 639 | WP_015065635 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| G7033_RS24860 (G7033_24860) | 5498..7453 | + | 1956 | WP_101455617 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| G7033_RS24865 (G7033_24865) | 7485..7739 | + | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
| G7033_RS24870 (G7033_24870) | 7717..7965 | + | 249 | WP_004152675 | hypothetical protein | - |
| G7033_RS24875 (G7033_24875) | 7978..8304 | + | 327 | WP_134874471 | hypothetical protein | - |
| G7033_RS24880 (G7033_24880) | 8325..9077 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| G7033_RS24885 (G7033_24885) | 9088..9327 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| G7033_RS24890 (G7033_24890) | 9299..9856 | + | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| G7033_RS24895 (G7033_24895) | 9902..10345 | + | 444 | WP_101455614 | F-type conjugal transfer protein TrbF | - |
| G7033_RS24900 (G7033_24900) | 10323..11702 | + | 1380 | WP_072198320 | conjugal transfer pilus assembly protein TraH | traH |
| G7033_RS24905 (G7033_24905) | 11702..14545 | + | 2844 | WP_134874469 | conjugal transfer mating-pair stabilization protein TraG | traG |
| G7033_RS24910 (G7033_24910) | 14556..15089 | + | 534 | WP_004197891 | hypothetical protein | - |
| G7033_RS24915 (G7033_24915) | 15499..16230 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| G7033_RS24920 (G7033_24920) | 16423..17112 | + | 690 | WP_074182184 | hypothetical protein | - |
| G7033_RS24925 (G7033_24925) | 17241..19553 | + | 2313 | WP_040120372 | type IV conjugative transfer system coupling protein TraD | virb4 |
Region 2: 110847..117522
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G7033_RS25450 (G7033_25450) | 106896..107276 | + | 381 | WP_020802391 | hypothetical protein | - |
| G7033_RS25455 (G7033_25455) | 107343..107690 | + | 348 | WP_032445771 | hypothetical protein | - |
| G7033_RS25460 (G7033_25460) | 107785..107931 | + | 147 | WP_004152750 | hypothetical protein | - |
| G7033_RS25465 (G7033_25465) | 107982..108815 | + | 834 | WP_032445769 | N-6 DNA methylase | - |
| G7033_RS25475 (G7033_25475) | 109631..110452 | + | 822 | WP_004152492 | DUF932 domain-containing protein | - |
| G7033_RS25480 (G7033_25480) | 110485..110814 | + | 330 | WP_011977736 | DUF5983 family protein | - |
| G7033_RS25485 (G7033_25485) | 110847..111332 | - | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
| G7033_RS25490 (G7033_25490) | 111764..112156 | + | 393 | WP_004194114 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| G7033_RS25495 (G7033_25495) | 112386..113087 | + | 702 | WP_040120380 | hypothetical protein | - |
| G7033_RS25500 (G7033_25500) | 113173..113373 | + | 201 | WP_046664192 | TraY domain-containing protein | - |
| G7033_RS25505 (G7033_25505) | 113441..113809 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| G7033_RS25510 (G7033_25510) | 113823..114128 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| G7033_RS25515 (G7033_25515) | 114148..114714 | + | 567 | WP_064161971 | type IV conjugative transfer system protein TraE | traE |
| G7033_RS25520 (G7033_25520) | 114701..115441 | + | 741 | WP_064169777 | type-F conjugative transfer system secretin TraK | traK |
| G7033_RS25525 (G7033_25525) | 115441..116865 | + | 1425 | WP_040228261 | F-type conjugal transfer pilus assembly protein TraB | traB |
| G7033_RS25530 (G7033_25530) | 116938..117522 | + | 585 | WP_040120377 | type IV conjugative transfer system lipoprotein TraV | traV |
| G7033_RS25540 (G7033_25540) | 117845..118063 | + | 219 | WP_004195468 | hypothetical protein | - |
| G7033_RS25545 (G7033_25545) | 118064..118375 | + | 312 | WP_029497417 | hypothetical protein | - |
| G7033_RS25550 (G7033_25550) | 118442..118846 | + | 405 | WP_004197817 | hypothetical protein | - |
| G7033_RS26060 | 118889..119041 | + | 153 | WP_224518895 | hypothetical protein | - |
| G7033_RS25560 (G7033_25560) | 119223..119621 | + | 399 | WP_023179972 | hypothetical protein | - |
Host bacterium
| ID | 19233 | GenBank | NZ_CP049601 |
| Plasmid name | pSECR18-2341_KPC | Incompatibility group | IncFII |
| Plasmid size | 119990 bp | Coordinate of oriT [Strand] | 111405..111453 [-] |
| Host baterium | Klebsiella aerogenes strain 18-2341 |
Cargo genes
| Drug resistance gene | blaKPC-2, blaOXA-9 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |