Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   118608
Name   oriT_p15WZ-82_Vir in_silico
Organism   Klebsiella variicola strain 15WZ-82
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP032356 (155785..155812 [+], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_p15WZ-82_Vir
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   13823 GenBank   WP_101415807
Name   traD_D4N21_RS28120_p15WZ-82_Vir insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79581.14 Da        Isoelectric Point: 8.8191

>WP_101415807.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSVYVLIDSWTSKYGISEIPFYCSLGLIAMACWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRIINNAHFFADDRKYQKLVNLQESGGAPSKNRVYKLFRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPITRHYRKLAFDLGGNYAIFGVDKKVPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQDGLKEECESLGKPFMHFHAGTPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFLRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGNDWHLTVQVSQNLALADEIDKLKEYFYCNYFEDNSPKNLHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVANPNRNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSASTKQSHTNFNGSISERKST
TMVSSIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVVDMVMTSPYKLKLRRNLDVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-654)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 213352..237445

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D4N21_RS29015 (D4N21_29155) 208583..208936 - 354 WP_072046272 hypothetical protein -
D4N21_RS29020 (D4N21_29160) 209081..210058 - 978 WP_128206178 hypothetical protein -
D4N21_RS29025 (D4N21_29165) 210391..212190 - 1800 WP_128206179 ATP-dependent helicase -
D4N21_RS29030 (D4N21_29170) 212471..213322 + 852 WP_004186952 hypothetical protein -
D4N21_RS29035 (D4N21_29175) 213352..216534 - 3183 WP_128206180 conjugal transfer protein TraN traN
D4N21_RS29040 (D4N21_29180) 216544..217581 - 1038 WP_004026524 IncHI-type conjugal transfer protein TrhU traU
D4N21_RS29045 (D4N21_29185) 217578..218939 - 1362 WP_128206181 TrbC family F-type conjugative pilus assembly protein traW
D4N21_RS29050 (D4N21_29190) 218926..219450 - 525 WP_128206182 signal peptidase I -
D4N21_RS29055 (D4N21_29195) 219588..223829 - 4242 WP_128206183 Ig-like domain-containing protein -
D4N21_RS29060 (D4N21_29200) 223957..224493 - 537 WP_032720870 hypothetical protein -
D4N21_RS29065 (D4N21_29205) 224481..224774 - 294 WP_128206184 hypothetical protein -
D4N21_RS29070 (D4N21_29210) 224860..225318 - 459 WP_032720872 hypothetical protein -
D4N21_RS29075 (D4N21_29215) 226004..226807 + 804 WP_099745297 metallophosphoesterase -
D4N21_RS29080 (D4N21_29220) 226797..227513 + 717 WP_116987722 hypothetical protein -
D4N21_RS29085 (D4N21_29225) 227500..228000 + 501 WP_099745299 hypothetical protein -
D4N21_RS29090 (D4N21_29230) 227972..228388 + 417 WP_224459619 trhZ -
D4N21_RS29095 (D4N21_29235) 228415..231132 - 2718 WP_116987720 TraC family protein virb4
D4N21_RS29100 (D4N21_29240) 231177..231914 - 738 WP_072046241 TraV family lipoprotein traV
D4N21_RS29105 (D4N21_29245) 231924..232775 - 852 WP_128206185 DsbC family protein -
D4N21_RS29110 (D4N21_29250) 232778..233242 - 465 WP_099745302 hypothetical protein -
D4N21_RS29115 (D4N21_29255) 233245..234618 - 1374 WP_176694865 TrbI/VirB10 family protein traB
D4N21_RS29120 (D4N21_29260) 234578..235096 - 519 WP_128206186 hypothetical protein -
D4N21_RS29125 (D4N21_29265) 235093..236262 - 1170 WP_099745304 type-F conjugative transfer system secretin TraK traK
D4N21_RS29130 (D4N21_29270) 236264..237124 - 861 WP_099745305 TraE/TraK family type IV conjugative transfer system protein traE
D4N21_RS29135 (D4N21_29275) 237143..237445 - 303 WP_099745306 type IV conjugative transfer system protein TraL traL
D4N21_RS29140 (D4N21_29280) 237547..237915 - 369 WP_072046247 pili assembly chaperone -
D4N21_RS29150 (D4N21_29290) 239181..239849 + 669 WP_128206187 hypothetical protein -
D4N21_RS29155 (D4N21_29295) 239904..240668 + 765 WP_099745345 hypothetical protein -
D4N21_RS29160 (D4N21_29300) 240796..241974 + 1179 WP_116987717 DNA-binding protein -

Host bacterium

ID   19041 GenBank   NZ_CP032356
Plasmid name   p15WZ-82_Vir Incompatibility group   IncFIB
Plasmid size   282290 bp Coordinate of oriT [Strand]   155785..155812 [+]
Host baterium   Klebsiella variicola strain 15WZ-82

Cargo genes

Drug resistance gene   -
Virulence gene   iroB, iroC, iroD, iroN, rmpA, iucA, iucB, iucC, iutA, pla
Metal resistance gene   terE, terD, terC, terB, terA, terZ, terW
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -