Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   118484
Name   oriT_FDAARGOS_431|unnamed in_silico
Organism   Raoultella ornithinolytica strain FDAARGOS_431
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP023892 (1528..1585 [-], 58 nt)
oriT length   58 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 58 nt

>oriT_FDAARGOS_431|unnamed
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   11735 GenBank   WP_185762470
Name   Relaxase_CRN13_RS28135_FDAARGOS_431|unnamed insolico UniProt ID   _
Length   233 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 233 a.a.        Molecular weight: 25692.08 Da        Isoelectric Point: 8.3463

>WP_185762470.1 relaxase/mobilization nuclease domain-containing protein, partial [Raoultella ornithinolytica]
MIVKFHPRGRGGGGGPVDYLLGKDRQRDGASVLQGKPDEVRELIDASPYAKKYTSGVLSFAEQDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHRDKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRVLVSPSALPEAKQEAAQAITSGLLALASSGELKTRQDVTEALESAGFEVVRTTKS
SISIADPDGGRNIRLKGAIYEQS

  Protein domains


Predicted by InterproScan.

(57-220)


  Protein structure



No available structure.




Auxiliary protein


ID   6767 GenBank   WP_004193914
Name   WP_004193914_FDAARGOS_431|unnamed insolico UniProt ID   A0A8T3UXZ2
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11783.55 Da        Isoelectric Point: 7.8963

>WP_004193914.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCEGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQIVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   18917 GenBank   NZ_CP023892
Plasmid name   FDAARGOS_431|unnamed Incompatibility group   ColRNAI
Plasmid size   2711 bp Coordinate of oriT [Strand]   1528..1585 [-]
Host baterium   Raoultella ornithinolytica strain FDAARGOS_431

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -