Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   118481
Name   oriT_FDAARGOS_431|unnamed in_silico
Organism   Raoultella ornithinolytica strain FDAARGOS_431
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP023887 (1128..1185 [+], 58 nt)
oriT length   58 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 58 nt

>oriT_FDAARGOS_431|unnamed
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   11733 GenBank   WP_185762440
Name   Relaxase_CRN13_RS00010_FDAARGOS_431|unnamed insolico UniProt ID   _
Length   233 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 233 a.a.        Molecular weight: 25802.28 Da        Isoelectric Point: 9.1532

>WP_185762440.1 relaxase/mobilization nuclease domain-containing protein, partial [Raoultella ornithinolytica]
MIVKFHPRGRGGGAGPVDYLLGKDRQRDGASVLQGKPEEVRELIDASPYAKKYTSGVLSFAEKDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHQDKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRALVTPSALPEAKQEAAQAITRGLLVLASSGELKTRQDVTEALENAGFEVVRTTKS
SISIADPDGGRNIRLKGAIYEQS

  Protein domains


Predicted by InterproScan.

(56-220)


  Protein structure



No available structure.




Auxiliary protein


ID   6765 GenBank   WP_185762441
Name   WP_185762441_FDAARGOS_431|unnamed insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11797.57 Da        Isoelectric Point: 7.8963

>WP_185762441.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Klebsiella/Raoultella group]
MLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGTGHDRVQIVAALMAIDAGLERLRHAVLEKGAEDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   18914 GenBank   NZ_CP023887
Plasmid name   FDAARGOS_431|unnamed Incompatibility group   Col440II
Plasmid size   3724 bp Coordinate of oriT [Strand]   1128..1185 [+]
Host baterium   Raoultella ornithinolytica strain FDAARGOS_431

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -