Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   118468
Name   oriT_pKPN1481-2 in_silico
Organism   Klebsiella variicola strain KPN1481
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP020851 (106339..106387 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_pKPN1481-2
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTTTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   13739 GenBank   WP_020316650
Name   traD_B8O08_RS29675_pKPN1481-2 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 85197.99 Da        Isoelectric Point: 4.8865

>WP_020316650.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRSLDARVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPAEVTV
SPAPVKATQTTKMPAEEPSVRATEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTEQELAQQ
SAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.



ID   13740 GenBank   WP_020316650
Name   traD_B8O08_RS30480_pKPN1481-2 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 85197.99 Da        Isoelectric Point: 4.8865

>WP_020316650.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRSLDARVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPAEVTV
SPAPVKATQTTKMPAEEPSVRATEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTEQELAQQ
SAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 108766..134285

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B8O08_RS30305 (B8O08_30255) 105219..105749 + 531 WP_015632491 antirestriction protein -
B8O08_RS30310 (B8O08_30260) 105787..106194 - 408 WP_020805750 transglycosylase SLT domain-containing protein -
B8O08_RS30315 (B8O08_30265) 106698..107090 + 393 WP_032419915 conjugal transfer relaxosome DNA-binding protein TraM -
B8O08_RS32590 107328..108029 + 702 WP_224324939 hypothetical protein -
B8O08_RS30325 (B8O08_30275) 108115..108315 + 201 WP_048289787 TraY domain-containing protein -
B8O08_RS30330 (B8O08_30280) 108384..108752 + 369 WP_020316649 type IV conjugative transfer system pilin TraA -
B8O08_RS30335 (B8O08_30285) 108766..109071 + 306 WP_004178059 type IV conjugative transfer system protein TraL traL
B8O08_RS30340 (B8O08_30290) 109091..109657 + 567 WP_020316627 type IV conjugative transfer system protein TraE traE
B8O08_RS30345 (B8O08_30295) 109644..110384 + 741 WP_020804840 type-F conjugative transfer system secretin TraK traK
B8O08_RS30350 (B8O08_30300) 110384..111808 + 1425 WP_023316397 F-type conjugal transfer pilus assembly protein TraB traB
B8O08_RS30355 (B8O08_30305) 111801..112397 + 597 WP_023316398 conjugal transfer pilus-stabilizing protein TraP -
B8O08_RS30360 (B8O08_30310) 112420..112989 + 570 WP_086893255 type IV conjugative transfer system lipoprotein TraV traV
B8O08_RS30365 (B8O08_30315) 113121..113531 + 411 WP_020805613 hypothetical protein -
B8O08_RS30370 (B8O08_30320) 113536..113820 + 285 WP_023316401 hypothetical protein -
B8O08_RS30375 (B8O08_30325) 113844..114062 + 219 WP_086893256 hypothetical protein -
B8O08_RS30380 (B8O08_30330) 114063..114380 + 318 WP_086893257 hypothetical protein -
B8O08_RS30385 (B8O08_30335) 114447..114851 + 405 WP_049246239 hypothetical protein -
B8O08_RS30390 (B8O08_30340) 114848..115138 + 291 WP_060578476 hypothetical protein -
B8O08_RS30395 (B8O08_30345) 115146..115544 + 399 WP_164996480 hypothetical protein -
B8O08_RS30400 (B8O08_30350) 115616..118255 + 2640 WP_086893259 type IV secretion system protein TraC virb4
B8O08_RS30405 (B8O08_30355) 118255..118644 + 390 WP_086893260 type-F conjugative transfer system protein TrbI -
B8O08_RS30410 (B8O08_30360) 118644..119270 + 627 WP_086893261 type-F conjugative transfer system protein TraW traW
B8O08_RS30415 (B8O08_30365) 119314..120273 + 960 WP_168712236 conjugal transfer pilus assembly protein TraU traU
B8O08_RS30420 (B8O08_30370) 120286..120924 + 639 WP_040107937 type-F conjugative transfer system pilin assembly protein TrbC trbC
B8O08_RS30425 (B8O08_30375) 120983..122938 + 1956 WP_086893262 type-F conjugative transfer system mating-pair stabilization protein TraN traN
B8O08_RS30430 (B8O08_30380) 122971..123252 + 282 WP_022644736 hypothetical protein -
B8O08_RS30435 (B8O08_30385) 123242..123469 + 228 WP_012540032 conjugal transfer protein TrbE -
B8O08_RS30440 (B8O08_30390) 123480..123806 + 327 WP_020323521 hypothetical protein -
B8O08_RS30445 (B8O08_30395) 123827..124579 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
B8O08_RS30450 (B8O08_30400) 124590..124829 + 240 WP_023340931 type-F conjugative transfer system pilin chaperone TraQ -
B8O08_RS30455 (B8O08_30405) 124801..125358 + 558 WP_086893263 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
B8O08_RS30460 (B8O08_30410) 125404..125847 + 444 WP_049248035 F-type conjugal transfer protein TrbF -
B8O08_RS30465 (B8O08_30415) 125825..127204 + 1380 WP_072198238 conjugal transfer pilus assembly protein TraH traH
B8O08_RS30470 (B8O08_30420) 127204..130026 + 2823 WP_020316632 conjugal transfer mating-pair stabilization protein TraG traG
B8O08_RS31255 130050..130652 + 603 WP_048263624 hypothetical protein -
B8O08_RS30475 (B8O08_30425) 130903..131634 + 732 WP_016831056 conjugal transfer complement resistance protein TraT -
B8O08_RS30480 (B8O08_30430) 131994..134285 + 2292 WP_020316650 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   18901 GenBank   NZ_CP020851
Plasmid name   pKPN1481-2 Incompatibility group   IncFII
Plasmid size   161100 bp Coordinate of oriT [Strand]   106339..106387 [-]
Host baterium   Klebsiella variicola strain KPN1481

Cargo genes

Drug resistance gene   aph(3'')-Ib, aph(6)-Id
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9