Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 118414 |
| Name | oriT_pMCR_1884_C3  |
| Organism | Citrobacter braakii strain 1884_17_C3 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MT929290 (53248..53300 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pMCR_1884_C3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 13696 | GenBank | WP_015059539 |
| Name | t4cp2_IST63_RS00105_pMCR_1884_C3 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 11421..34884
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IST63_RS00375 | 6821..7027 | - | 207 | WP_001356702 | hypothetical protein | - |
| IST63_RS00380 | 7056..7475 | - | 420 | WP_228026879 | hypothetical protein | - |
| IST63_RS00045 | 7487..8611 | - | 1125 | WP_000486716 | site-specific integrase | - |
| IST63_RS00050 | 8749..8904 | + | 156 | WP_001358489 | hypothetical protein | - |
| IST63_RS00415 | 9162..9396 | + | 235 | Protein_11 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| IST63_RS00055 | 9393..10769 | - | 1377 | WP_000750519 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| IST63_RS00060 | 10782..11417 | - | 636 | WP_000934977 | A24 family peptidase | - |
| IST63_RS00065 | 11421..11903 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| IST63_RS00070 | 11969..12526 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| IST63_RS00075 | 12571..13680 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| IST63_RS00080 | 13671..15209 | - | 1539 | WP_000466225 | GspE/PulE family protein | virB11 |
| IST63_RS00085 | 15234..15728 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| IST63_RS00090 | 15712..17034 | - | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| IST63_RS00095 | 17073..18716 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| IST63_RS00100 | 18709..19251 | - | 543 | WP_001220544 | sigma 54-interacting transcriptional regulator | virb4 |
| IST63_RS00105 | 19298..21256 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| IST63_RS00110 | 21272..22327 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| IST63_RS00115 | 22346..23485 | - | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| IST63_RS00120 | 23475..24176 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
| IST63_RS00125 | 24242..24976 | - | 735 | WP_000432282 | virB8 family protein | virB8 |
| IST63_RS00130 | 25142..27499 | - | 2358 | WP_063078682 | VirB4 family type IV secretion system protein | virb4 |
| IST63_RS00135 | 27505..27825 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| IST63_RS00385 | 27896..28186 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| IST63_RS00145 | 28186..28770 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| IST63_RS00150 | 28791..29189 | - | 399 | WP_001153665 | hypothetical protein | - |
| IST63_RS00155 | 29308..29745 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| IST63_RS00160 | 29751..30986 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| IST63_RS00165 | 30989..31288 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| IST63_RS00170 | 31356..31637 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| IST63_RS00175 | 31627..31878 | - | 252 | WP_000121741 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| IST63_RS00180 | 31978..32613 | - | 636 | WP_015059536 | hypothetical protein | - |
| IST63_RS00185 | 32686..32973 | - | 288 | WP_001032611 | EexN family lipoprotein | - |
| IST63_RS00190 | 32986..33240 | - | 255 | WP_001043555 | EexN family lipoprotein | - |
| IST63_RS00195 | 33242..33883 | - | 642 | WP_001425343 | type IV secretion system protein | - |
| IST63_RS00200 | 33889..34884 | - | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| IST63_RS00205 | 34888..35145 | - | 258 | WP_000739144 | hypothetical protein | - |
| IST63_RS00210 | 35142..35495 | - | 354 | WP_223286767 | hypothetical protein | - |
| IST63_RS00215 | 35715..36161 | - | 447 | WP_001243165 | hypothetical protein | - |
| IST63_RS00220 | 36172..36342 | - | 171 | WP_000550720 | hypothetical protein | - |
| IST63_RS00225 | 36346..36789 | - | 444 | WP_000964330 | NfeD family protein | - |
| IST63_RS00230 | 37163..38116 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| IST63_RS00235 | 38143..38319 | - | 177 | WP_000753050 | hypothetical protein | - |
| IST63_RS00240 | 38312..38527 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| IST63_RS00245 | 38520..39026 | - | 507 | WP_001326595 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 18847 | GenBank | NZ_MT929290 |
| Plasmid name | pMCR_1884_C3 | Incompatibility group | IncI2 |
| Plasmid size | 60164 bp | Coordinate of oriT [Strand] | 53248..53300 [-] |
| Host baterium | Citrobacter braakii strain 1884_17_C3 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |