Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   118205
Name   oriT_ZS-10|unnamed1 in_silico
Organism   Salinigranum marinum strain ZS-10
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP100462 (84055..84073 [-], 19 nt)
oriT length   19 nt
IRs (inverted repeats)      3..9, 13..19  (GCGAACG..CGTTCGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 19 nt

>oriT_ZS-10|unnamed1
ACGCGAACGGAACGTTCGC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   11565 GenBank   WP_318570774
Name   Replic_Relax_NKJ07_RS20495_ZS-10|unnamed1 insolico UniProt ID   _
Length   159 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 159 a.a.        Molecular weight: 16823.74 Da        Isoelectric Point: 3.9537

>WP_318570774.1 helix-turn-helix domain-containing protein [Salinigranum marinum]
MVFGDPTETPGFGGDAEAAAVLDALGDAVSREILTAAAGAPVTVEQLATICGVSESTVYRRLDRLNTLGL
VERCNPLVSEAKGAYRTTMRGLYVAVDGGQIAVTADGSPDEALASALRLVAEAVDLRRLSYDRDAGTVDL
TLSFDDDDFQTFLRLYTDD

  Protein domains


Predicted by InterproScan.

Helix-turn-helix domain (HTH_20)

(20-74)


  Protein structure



No available structure.




Host bacterium

ID   18638 GenBank   NZ_CP100462
Plasmid name   ZS-10|unnamed1 Incompatibility group   -
Plasmid size   437029 bp Coordinate of oriT [Strand]   84055..84073 [-]
Host baterium   Salinigranum marinum strain ZS-10

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -