Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   118118
Name   oriT_pOSUMEAT1 in_silico
Organism   Raoultella ornithinolytica strain OHMEATKPC2_NDM5
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP054271 (6118..6167 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pOSUMEAT1
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   6612 GenBank   WP_032700831
Name   WP_032700831_pOSUMEAT1 insolico UniProt ID   A0A485D480
Length   129 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 129 a.a.        Molecular weight: 14705.63 Da        Isoelectric Point: 4.4711

>WP_032700831.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Klebsiella/Raoultella group]
MARVQAYASDEVAEKINAIVEKRKAEGAKDKDVSFSSVASMLLELGLRVYEAQMERKESGFNQAEFNKML
LENVIKTQFSISKVLAMESLSPHIQGDERFDFKSMVMNIRDDAKEVVERFFPDTDDEES

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A485D480


T4CP

ID   13434 GenBank   WP_040118437
Name   traD_HRV96_RS26630_pOSUMEAT1 insolico UniProt ID   _
Length   776 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 776 a.a.        Molecular weight: 86788.85 Da        Isoelectric Point: 4.9734

>WP_040118437.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella/Raoultella group]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFIIFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTINYYGRSLEYNAEQILADKYTIWCGEQLWTSFVLAAVVSLVICIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILLNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLSLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFATGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRSLDTRVDTRLSALLEAREAEGSLARALFTPDAPAPDPAEKDVKVGNTPEQSQPAE
SIESPATVKVPATAKTPAADEIGQSPETPEPAAPVTKVVTVPLIRPRSATATGTAAVATTAASTTSATTV
PAGGTEQELAQQPTEQGQDRLPAGMNDDGVIEDMDAYDAWLAGEQTQRDMQRREEVNINHSHRRDEQDDI
EIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 158292..180567

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HRV96_RS26630 (HRV96_26525) 158292..160622 - 2331 WP_040118437 type IV conjugative transfer system coupling protein TraD virb4
HRV96_RS26635 (HRV96_26530) 160816..161547 - 732 WP_032716670 conjugal transfer complement resistance protein TraT -
HRV96_RS26640 (HRV96_26535) 161742..162356 - 615 WP_032732092 hypothetical protein -
HRV96_RS26645 (HRV96_26540) 162382..165204 - 2823 WP_040118409 conjugal transfer mating-pair stabilization protein TraG traG
HRV96_RS26650 (HRV96_26545) 165204..166574 - 1371 WP_032700807 conjugal transfer pilus assembly protein TraH traH
HRV96_RS26655 (HRV96_26550) 166561..166989 - 429 WP_032700808 conjugal transfer protein TrbF -
HRV96_RS26660 (HRV96_26555) 166982..167548 - 567 WP_032732090 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HRV96_RS26665 (HRV96_26560) 167523..167759 - 237 WP_032700810 type-F conjugative transfer system pilin chaperone TraQ -
HRV96_RS26670 (HRV96_26565) 167770..168522 - 753 WP_040118410 type-F conjugative transfer system pilin assembly protein TraF traF
HRV96_RS26675 (HRV96_26570) 168545..168871 - 327 WP_032700812 hypothetical protein -
HRV96_RS26680 (HRV96_26575) 169161..170129 - 969 WP_000654811 IS5 family transposase -
HRV96_RS26685 (HRV96_26580) 170209..172164 - 1956 WP_040118411 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HRV96_RS26690 (HRV96_26585) 172164..172793 - 630 WP_032700817 type-F conjugative transfer system pilin assembly protein TrbC trbC
HRV96_RS26695 (HRV96_26590) 172806..173765 - 960 WP_032716690 conjugal transfer pilus assembly protein TraU traU
HRV96_RS26700 (HRV96_26595) 173806..174435 - 630 WP_032716660 type-F conjugative transfer system protein TraW traW
HRV96_RS26705 (HRV96_26600) 174432..174824 - 393 WP_032716659 type-F conjugative transfer system protein TrbI -
HRV96_RS26710 (HRV96_26605) 174824..177463 - 2640 WP_032716658 type IV secretion system protein TraC virb4
HRV96_RS26715 (HRV96_26610) 177543..177932 - 390 WP_040118412 hypothetical protein -
HRV96_RS26720 (HRV96_26615) 177963..178313 - 351 WP_234972282 hypothetical protein -
HRV96_RS26725 (HRV96_26620) 178310..178714 - 405 WP_040118414 hypothetical protein -
HRV96_RS26730 (HRV96_26625) 178711..178932 - 222 WP_032732073 hypothetical protein -
HRV96_RS26735 (HRV96_26630) 179983..180567 - 585 WP_234972283 type IV conjugative transfer system lipoprotein TraV traV

Host bacterium

ID   18551 GenBank   NZ_CP054271
Plasmid name   pOSUMEAT1 Incompatibility group   IncFIB
Plasmid size   180641 bp Coordinate of oriT [Strand]   6118..6167 [+]
Host baterium   Raoultella ornithinolytica strain OHMEATKPC2_NDM5

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -