Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   117992
Name   oriT_p2HDMI12 in_silico
Organism   Candidatus Hamiltonella defensa strain MI12 isolate MI12
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP023990 (41129..41174 [+], 46 nt)
oriT length   46 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 46 nt

>oriT_p2HDMI12
TTTAAAGCAAAAAACGGATGCTCCATACTCGCCATTTCATCCCTGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   11413 GenBank   WP_235661299
Name   mobP1_CJJ19_RS11285_p2HDMI12 insolico UniProt ID   _
Length   387 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 387 a.a.        Molecular weight: 45210.74 Da        Isoelectric Point: 10.6861

>WP_235661299.1 MobP1 family relaxase [Candidatus Hamiltonella defensa]
MMGVKVKKEERIRRVAEQRREKIRRFPEAHKARHGGKNYSRGVRDRAFKNGNSREVLVRITGSGRTPRGV
KNEINYIAREGELTLRDSEGKEYCIQEREERHQSYAFMTDQEDKQGHRDESAPKLVHNMVFSSPNVASVS
EADAFKAVETTLKEKYPDNRFIMAYHKDTDSHHVHVLLRIPDNYGKRINIRKQDLRDLREKFAGQLQKMG
YNVTCTHQYQFGLKSELKREHDRQRGLYEVVKFGRASYRFNPKNGDQNYITLRTLKNKTEVTYWGVNLAE
EIEREQIKTGSVISFKKEGATAVKVPKLNRQGKQVGWTQTHRNHWRIENQAQMGIKPKPFPKEIKLDSPE
QLMKHKRSMSVFKQSKAAMLVLKEQLKKGIKMGGIKF

  Protein domains



No domain identified.



  Protein structure



No available structure.




T4CP


ID   13338 GenBank   WP_171967947
Name   t4cp2_CJJ19_RS11210_p2HDMI12 insolico UniProt ID   _
Length   309 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 309 a.a.        Molecular weight: 35377.55 Da        Isoelectric Point: 5.2281

>WP_171967947.1 hypothetical protein [Candidatus Hamiltonella defensa]
MTGFAPFMLDATQRNVIFVKQLMKIICTLNGNTLTTREELRLNTGVARVMALPHDVRRFGVTALINHISE
PDNREARENGVKIRLSRWAQGGDLAWVFDNDNDTFDLSQYDNFGIDGTEFLDNPEVCPAIAFYLLYRVTR
LLDGRRLVIFMDEFWQWIGNPAFADFVYNRLKTMRKLNGIIIPATQSPEEILKSSVSGAMREQCTTHIYL
ANPKADYDQYVNQLKVPERYFNIIKNLDPLSRQFLIVKSPLYKGNLNDFAALVTLDLSGLGVTTKLLSTD
KDDLEVFDSLFKDGLRPDEWIDTYLKLVS

  Protein domains


Predicted by InterproScan.

(137-210)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 3075..25046

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CJJ19_RS11085 (CJJ19_11160) 15..731 + 717 WP_171967940 StbB family protein -
CJJ19_RS11090 (CJJ19_11165) 733..1041 + 309 WP_015873781 plasmid stabilization protein StbC -
CJJ19_RS11095 (CJJ19_11170) 1283..2401 - 1119 WP_235661303 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
CJJ19_RS11100 (CJJ19_11175) 2413..3078 - 666 WP_171967941 A24 family peptidase -
CJJ19_RS11105 (CJJ19_11180) 3075..3536 - 462 WP_171967960 lytic transglycosylase domain-containing protein virB1
CJJ19_RS11110 (CJJ19_11185) 3631..4257 - 627 WP_235661304 type 4 pilus major pilin -
CJJ19_RS11115 (CJJ19_11190) 4261..5361 - 1101 WP_171967942 type II secretion system F family protein -
CJJ19_RS11120 (CJJ19_11195) 5470..5949 + 480 WP_100097226 Hsp20 family protein -
CJJ19_RS11125 (CJJ19_11200) 5988..7496 - 1509 WP_171967962 GspE/PulE family protein virB11
CJJ19_RS11130 (CJJ19_11205) 7514..7978 - 465 WP_100097227 type IV pilus biogenesis protein PilP -
CJJ19_RS12420 (CJJ19_11215) 8003..8767 - 765 WP_235661311 type 4b pilus protein PilO2 -
CJJ19_RS11140 (CJJ19_11220) 8689..9255 - 567 WP_171967943 type 4b pilus protein PilO2 -
CJJ19_RS12425 9255..9749 - 495 WP_235661305 hypothetical protein -
CJJ19_RS12430 9752..10099 - 348 WP_235661306 hypothetical protein -
CJJ19_RS12435 10105..10893 - 789 WP_235661307 secretin N-terminal domain-containing protein -
CJJ19_RS11150 (CJJ19_11230) 10992..11441 - 450 WP_235661308 type IV pilus biogenesis protein PilM -
CJJ19_RS11155 (CJJ19_11235) 11438..12355 - 918 WP_171967944 cag pathogenicity island Cag12 family protein -
CJJ19_RS11160 (CJJ19_11240) 12398..14250 - 1853 Protein_18 type IV secretory system conjugative DNA transfer family protein -
CJJ19_RS11165 (CJJ19_11245) 14237..15268 - 1032 WP_171967945 P-type DNA transfer ATPase VirB11 virB11
CJJ19_RS11170 (CJJ19_11250) 15265..16656 - 1392 WP_320410335 VirB10/TraB/TrbI family type IV secretion system protein virB10
CJJ19_RS11175 (CJJ19_11255) 16653..17582 - 930 WP_015873769 P-type conjugative transfer protein VirB9 virB9
CJJ19_RS11180 (CJJ19_11260) 17585..18463 - 879 WP_235661310 virB8 family protein virB8
CJJ19_RS11185 (CJJ19_11265) 18654..19241 + 588 WP_171967946 recombinase family protein -
CJJ19_RS11190 (CJJ19_11270) 19299..20288 - 990 WP_171967965 type IV secretion system protein virB6
CJJ19_RS11195 (CJJ19_11275) 20198..20488 - 291 WP_050879624 type IV secretion system protein virB6
CJJ19_RS11200 (CJJ19_11280) 20546..20833 - 288 WP_015873764 EexN family lipoprotein -
CJJ19_RS11205 (CJJ19_11285) 20830..21575 - 746 Protein_27 type IV secretion system protein -
CJJ19_RS11210 (CJJ19_11290) 21586..22515 - 930 WP_171967947 hypothetical protein virb4
CJJ19_RS11215 (CJJ19_11295) 22512..22904 - 393 WP_171967948 hypothetical protein virb4
CJJ19_RS11220 (CJJ19_11300) 22904..24334 - 1431 WP_171967949 VirB3 family type IV secretion system protein virb4
CJJ19_RS11225 (CJJ19_11305) 24349..24624 - 276 WP_015873762 TrbC/VirB2 family protein virB2
CJJ19_RS11230 (CJJ19_11310) 24645..25046 - 402 WP_171967950 transglycosylase SLT domain-containing protein virB1
CJJ19_RS11235 (CJJ19_11315) 25130..25357 - 228 WP_171967951 hypothetical protein -
CJJ19_RS11240 (CJJ19_11320) 25382..25699 - 318 WP_015873760 hypothetical protein -
CJJ19_RS11250 (CJJ19_11330) 26543..27163 - 621 WP_171967952 helix-turn-helix domain-containing protein -
CJJ19_RS11255 (CJJ19_11335) 27160..27375 - 216 WP_234817550 hypothetical protein -
CJJ19_RS11260 27416..27553 - 138 WP_158531027 hypothetical protein -
CJJ19_RS11265 (CJJ19_11340) 27647..28159 - 513 WP_100097242 DNA-3-methyladenine glycosylase -
CJJ19_RS11270 (CJJ19_11345) 28163..28384 - 222 WP_100097243 hypothetical protein -
CJJ19_RS11275 (CJJ19_11350) 28374..29381 - 1008 WP_171967953 Rpn family recombination-promoting nuclease/putative transposase -


Host bacterium


ID   18425 GenBank   NZ_CP023990
Plasmid name   p2HDMI12 Incompatibility group   -
Plasmid size   42977 bp Coordinate of oriT [Strand]   41129..41174 [+]
Host baterium   Candidatus Hamiltonella defensa strain MI12 isolate MI12

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA7