Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   117991
Name   oriT_pHDA2C.3 in_silico
Organism   Candidatus Hamiltonella defensa strain A2C
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP017609 (36394..36473 [-], 80 nt)
oriT length   80 nt
IRs (inverted repeats)      24..30, 33..39  (CGCTTGC..GCAAGCG)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 80 nt

>oriT_pHDA2C.3
GGACAAGATATGTTTTGAAGCACCGCTTGCAAGCAAGCGTCCCTTCAAAACTCTTGGTCAGTGCTTCGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   11412 GenBank   WP_234811192
Name   traI_BJP41_RS12400_pHDA2C.3 insolico UniProt ID   _
Length   267 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 267 a.a.        Molecular weight: 31598.12 Da        Isoelectric Point: 9.5250

>WP_234811192.1 TraI/MobA(P) family conjugative relaxase [Candidatus Hamiltonella defensa]
MFESARHSLKALGMSDHQYVTAIHRDTDHLHCHVAANRIHPVTYKVADDAYDISKLHKASREMELKYGWT
RTHGCYVINDHHQVVRSYSHQKPMPIEAKKLEYYSDKESFYGYAVRECREEISKILGEKNLYWERLHAVL
IRAGLELKKKDRGLAIYDRVHPEQTPLKASSLHPQLTLSKLVPRLGEFESAPRVMEFKNEQWEVTLTNYM
VSSHYDDRLHLRDHQARMTRRLERAEAREELKLRYQHDKKKRNALLLTQKIVSELFP

  Protein domains


Predicted by InterproScan.

(1-187)


  Protein structure



No available structure.




T4CP


ID   13337 GenBank   WP_100103847
Name   trbC_BJP41_RS11130_pHDA2C.3 insolico UniProt ID   _
Length   709 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 709 a.a.        Molecular weight: 79919.21 Da        Isoelectric Point: 7.4644

>WP_100103847.1 F-type conjugative transfer protein TrbC [Candidatus Hamiltonella defensa]
MNKRPSSLDPHRINRPVFNPSLTDTVLSPTGVQWGFLIALVLGCLWPVTLLMGLPACVILLIIFCDRPFR
MPIRLPTDIGGPDLTTEQEGFKARKGGAGLFSFITRTRHCEQAAGILCLGYARGKSLARELWLNLDDALR
HIQLIATTGAGKTEAILSVYLNALCWGRGMCLSDGKAENKLAFAVLSLARRFGREDDVYVLNFLTAGNSK
FSDLMKDNKSRPQSNSINLFANASETFIIQLMDSLLPKVGSNENGWQEKAKAMIAALIYALCYKREKDGL
FLSQRVIQDYLPLRKIVELYQEAKKNHWHEEGYKPLEHYLNTLPGFDMALIDSPSEWSKTVWEQHGFLIQ
QFTRMLSLFNDIYGQVFPQGAGDIDLKDVLHNDRILVVLIPALELSNSEAATLGKLYISGLRMTLSQDLG
GQLEGKREDVLLSQKFAQQFPYPIIFDELGAYFASGIDKMAAQMRSLQYMLMIAAQDVQSMMDKSMREFL
TVSANQRTKWFMALEDAQDTFNLIRSAAGKGYYSELSSVKRKGSLSGSRYEDADTHHIRERDNIELTELK
ALNKGEGVILFQDAVVRSAAIFIPDEEKLSSKLPMRINRFIELKRPTFDALCEVVPELRHQGDSFKQEVN
GILKKLEQPPQKKARMEDKTLMAVATLALNLDNRNDLSYTPEERGILLFEAARHALKKTQGQYTMEKEPK
EIALEHSTP

  Protein domains


Predicted by InterproScan.

(128-286)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 4755..29992

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BJP41_RS10940 (BJP41_10540) 1..597 + 597 WP_234811177 toxin co-regulated pilus biosynthesis Q family protein -
BJP41_RS10945 (BJP41_10545) 594..2276 + 1683 WP_100103824 PilN family type IVB pilus formation outer membrane protein -
BJP41_RS10950 (BJP41_10550) 2288..2626 - 339 WP_100103825 helix-turn-helix domain-containing protein -
BJP41_RS10955 (BJP41_10555) 2607..2987 - 381 WP_100103826 type II toxin-antitoxin system RelE/ParE family toxin -
BJP41_RS10960 (BJP41_10560) 3051..4361 + 1311 WP_100103827 type 4b pilus protein PilO2 -
BJP41_RS10965 (BJP41_10565) 4348..4758 + 411 WP_100103828 type IV pilus biogenesis protein PilP -
BJP41_RS10970 (BJP41_10570) 4755..6302 + 1548 WP_100103829 GspE/PulE family protein virB11
BJP41_RS10975 (BJP41_10575) 6289..7353 + 1065 WP_100103830 type II secretion system F family protein -
BJP41_RS10980 (BJP41_10580) 7365..7874 + 510 WP_100103496 type 4 pilus major pilin -
BJP41_RS10985 (BJP41_10585) 8127..9491 + 1365 WP_100103831 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
BJP41_RS10990 (BJP41_10590) 9543..9974 + 432 WP_100103832 type IV pilus biogenesis protein PilM -
BJP41_RS10995 (BJP41_10595) 9977..10597 + 621 WP_193432766 prepilin peptidase -
BJP41_RS11000 (BJP41_10600) 10640..11110 + 471 WP_100103834 lytic transglycosylase domain-containing protein virB1
BJP41_RS11005 (BJP41_10605) 11165..11614 + 450 WP_100103835 DotD/TraH family lipoprotein -
BJP41_RS11010 (BJP41_10610) 11611..12426 + 816 WP_100103836 type IV secretion system DotC family protein traI
BJP41_RS11015 (BJP41_10615) 12413..13009 + 597 Protein_15 ATPase, T2SS/T4P/T4SS family -
BJP41_RS11020 (BJP41_10620) 13066..13443 + 378 WP_012737971 IS630 transposase-related protein -
BJP41_RS11025 (BJP41_10625) 13367..13888 + 522 WP_320410290 IS630 family transposase -
BJP41_RS11030 (BJP41_10630) 13971..14483 + 513 WP_234811178 ATPase, T2SS/T4P/T4SS family -
BJP41_RS11035 (BJP41_10635) 14545..14805 + 261 WP_100103837 IcmT/TraK family protein traK
BJP41_RS11040 (BJP41_10640) 14820..16985 + 2166 WP_234811179 LPD7 domain-containing protein -
BJP41_RS12380 (BJP41_10645) 16982..17554 + 573 WP_234811181 hypothetical protein -
BJP41_RS11045 (BJP41_10650) 17566..17997 + 432 WP_100103838 conjugal transfer protein TraL traL
BJP41_RS11050 (BJP41_10655) 18080..18694 + 615 WP_234811183 DotI/IcmL/TraM family protein traM
BJP41_RS11055 (BJP41_10660) 18733..19698 + 966 WP_234811185 DotH/IcmK family type IV secretion protein traN
BJP41_RS11060 (BJP41_10665) 19702..20874 + 1173 WP_100103841 conjugal transfer protein TraO traO
BJP41_RS11065 (BJP41_10670) 20871..21623 + 753 WP_100103842 conjugal transfer protein TraP traP
BJP41_RS11070 (BJP41_10675) 21637..22176 + 540 WP_100096804 conjugal transfer protein TraQ traQ
BJP41_RS11075 (BJP41_10680) 22234..22629 + 396 WP_100103843 DUF6750 family protein traR
BJP41_RS11080 (BJP41_10685) 22673..23368 + 696 WP_193432912 TraT conjugal transfer protein traT
BJP41_RS12385 23365..24495 + 1131 WP_234811187 hypothetical protein traU
BJP41_RS12390 24467..25378 + 912 WP_234811189 hypothetical protein traU
BJP41_RS11090 (BJP41_10695) 25394..25927 - 534 WP_086934965 IS630 family transposase -
BJP41_RS11095 (BJP41_10700) 25839..26216 - 378 WP_234811160 IS630 transposase-related protein -
BJP41_RS11105 (BJP41_10705) 26503..27138 + 636 WP_100103844 plasmid IncI1-type surface exclusion protein ExcA -
BJP41_RS11110 (BJP41_10710) 27161..27490 - 330 WP_234811167 type II toxin-antitoxin system RelE/ParE family toxin -
BJP41_RS11115 (BJP41_10715) 27503..27772 - 270 WP_044612608 hypothetical protein -
BJP41_RS11120 (BJP41_10720) 27886..28980 + 1095 WP_100103845 conjugal transfer protein TrbA trbA
BJP41_RS11125 (BJP41_10725) 29099..29992 + 894 WP_234811168 DsbC family protein trbB
BJP41_RS11130 (BJP41_10730) 29985..32114 + 2130 WP_100103847 F-type conjugative transfer protein TrbC -
BJP41_RS11135 (BJP41_10735) 32121..32402 - 282 WP_100103848 ProQ/FINO family protein -
BJP41_RS11140 (BJP41_10740) 32690..33652 - 963 WP_100103849 Rpn family recombination-promoting nuclease/putative transposase -
BJP41_RS11145 (BJP41_10745) 33658..34014 - 357 WP_100103850 HU family DNA-binding protein -
BJP41_RS12395 (BJP41_10750) 34152..34811 - 660 WP_234811169 LPD7 domain-containing protein -


Host bacterium


ID   18424 GenBank   NZ_CP017609
Plasmid name   pHDA2C.3 Incompatibility group   -
Plasmid size   50279 bp Coordinate of oriT [Strand]   36394..36473 [-]
Host baterium   Candidatus Hamiltonella defensa strain A2C

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -