Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   117974
Name   oriT_FDAARGOS_1332|unnamed1 in_silico
Organism   Klebsiella oxytoca strain FDAARGOS_1332
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP069944 (203309..203390 [-], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_FDAARGOS_1332|unnamed1
GGGACAGGATGTGATTTGTTGAACCGCCACCACGGTGTCGGCCCCAACAAATCTCCTGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   11402 GenBank   WP_049593947
Name   traI_I6K62_RS28070_FDAARGOS_1332|unnamed1 insolico UniProt ID   A0A2J5PVP5
Length   623 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 623 a.a.        Molecular weight: 71450.50 Da        Isoelectric Point: 8.8378

>WP_049593947.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Klebsiella]
MIAKVPDGRRDGRSSFLQLITYNCIRDELSPEEALREDARFRRPSRSREACFERLVEYIDRSQNAGEGEG
TEIMLENGDSRIAVNGVVIQHNCFSLKTAPVEMAATAMANRRCEEPVFHYILSWQEDENPDPDIIFSCVA
DTQKALGLEGNQYVAAIHRDTDNVHVHIATNRVCPRTFKAATLSFSKERLQRSCRQLELKHGFRHDNGSW
KVDEKGHVVRAKKRMKVLPEGAARLEHFADTESLTTYARQHCFEQIDRLLSGPHFSWGAAHEILCAAGLC
LDRKGEGLAIYSLYDTAQTPIRASRLHPDLTLKQEATAGAFQSPDWYPDSHNRYRNTLHVRDQGARAERR
EARANARLELRARYERYRRDWKKPDLDVAGRFRAIAAEARDRKAEVRRRGRTADPQIRRLAYNIIAFEKM
QKEAALRLQLREERATLHVAGKLRPMTYRGWVEQEAVKGDVAAISQLRGWHYRSKRKGFPTNSIVYCAPA
DDVGIMEAPEFEATVRRDGVVVYCRNGWAEVADYGDRLEVVTPKEIPSMWFAVGAASLKSGEHVSFSNDP
DFRTRACRTVAEFNREFPSRRLALQEPEQRRIVEAEQNRYTSQEQPRRQEQQDSPQGGMVWKP

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(52-312)


  Protein structure


Source ID Structure
AlphaFold DB A0A2J5PVP5


T4CP

ID   13322 GenBank   WP_029074264
Name   t4cp2_I6K62_RS27525_FDAARGOS_1332|unnamed1 insolico UniProt ID   _
Length   662 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 662 a.a.        Molecular weight: 73142.66 Da        Isoelectric Point: 6.5145

>WP_029074264.1 MULTISPECIES: conjugal transfer protein TraG [Pseudomonadota]
MRGGRILWGQIAVVFTIVLVMTWAATQWVAFRLGFQPQLGNPWFELVGLPVYYPPAFFWWWFSFDAYAPA
IFVEGGIIAVSGGFLAIAAAILMSIIRAREARNVATYGSARWAEDREIRTAGLLGPDGVLLGRYNRDYLR
HDGPEHVLCFAPTRSGKGVGLVVPTLLTWSASAIVHDIKGENWTLTAGFRAKHGRVLLFDPTNARSSAYN
PLLEVRQGEWEVRDVQNIADILVDPEGSLDKRNHWEKTSHSLLVGAILHVLYAEKDKTLAGVANFLSDPR
RPVEATLRAMMDTPHLGEAGVHPVIASSARELLNKSENERSGVLSTAMSFLGLYRDPVVAQVTARCDWRI
ADLVGSRRPVTLYLVVPPSDINRTKPLIRLILNQIGRRLTEELTTSGKRHRLLLMLDEFPALGRLDFFES
ALAFMAGYGIKGFLIAQSLNQIERAYGPNNAILDNCHVRVSFATNDERTAKRVSDALGTATELRDSTNYA
GHRLAPWLGHLMVSRQETARPLLTPGEIMQLPPTDEIVMVAGTPPIRATKARYFEDARFQERILTPPDLV
AAPLAPSPSADDWSGRVVAAGSRSATVAADATEGDPANAGIRREPELPEHEEIVTPPPSPEQEFDILDDE
PDVDAAKARTIRQRMRMVARQVAMNPDDGIEL

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(112-555)

  Protein structure



No available structure.



ID   13323 GenBank   WP_029074259
Name   trbE_I6K62_RS27560_FDAARGOS_1332|unnamed1 insolico UniProt ID   _
Length   830 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 830 a.a.        Molecular weight: 90719.49 Da        Isoelectric Point: 5.3930

>WP_029074259.1 MULTISPECIES: conjugal transfer protein TrbE [Pseudomonadota]
MMNLSEYRRTAARLADYLPWAALLGSGVVLNKDGSFQRTAKFRGPDLDSAVAAELVAVAGRINNAVRRLG
SGWSIFVEAQRSEAATYPDSTFPDAASALVDAERKAGFEEAGTHFVSGYFLTFLWLPPAEEAARAETWLY
EGREKTGVDPWELLRGFIDRTDRVLALLDGFMPECRWMDDGATLTYLHSTISTNRHRVRVPEVPMHLDAL
LADQPLTGGLEPRLGTKHLRVLTIVGFPTATTPGLLDEMNRLPFPYRWSTRAILLDKTDATRLLTRIRRQ
WFAKRKSIAAILKEVMTNEASALVDTDAANKALDADMALQELGADVAGMAYVTATVTVWDADPRLADEKL
RLVEKIVQGRDFTAMPESVNAVDAWLGSLPGHAYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFGAPP
LLFGKTEGSTPFRLSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQVFAFDFGGSIRAAALAMG
GDWHDLGGGLTEGAEASVSLQPLARIHDTYERAWAADWIAAILMREGIAITPEVKEYLWTALTSLASAPV
EERTITGLAVLLQSNDLKQALRPFCVGGAYGRLLDAEAEHLGSADVQAFEIEGLVGTGAAPAVLSYLFHR
IGDRLDGRPTLLIIDEGWLALDDEGFAGQLREWLKTLRKKNASVIFATQSLSDIDGSNIAPAIIESCPTR
LLLPNERAIEPQITEIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEIGLALCAASAKSDQ
TLIAQIVAEHGRDGFLAAWLRARGVEWAAELIPNLTNLADRPESAAPARLDTHPTQEILP

  Protein domains


Predicted by InterproScan.

CagE, TrbE, VirB family, component of type IV transporter system (CagE_TrbE_VirB)

(183-388)

TraG P-loop domain (P-loop_TraG)

(576-730)

  Protein structure



No available structure.



ID   13324 GenBank   WP_049593958
Name   trbC_I6K62_RS27995_FDAARGOS_1332|unnamed1 insolico UniProt ID   _
Length   719 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 719 a.a.        Molecular weight: 81251.56 Da        Isoelectric Point: 7.4534

>WP_049593958.1 F-type conjugative transfer protein TrbC [Klebsiella oxytoca]
MNKPAVDTRRVNREVWQDGLSGLLFTPEIFLLVIVITTCIGWFFPATWLLSGPFLVLCVPIVLGNPWRMP
MRMPATMNRPDPSTDIAVRYRFVSWLPFGGIRIRRNPGAGILYLGFQRLKDAGRELWLSMDDLTRHTLFL
GTTGAGKTEFLLGVCLNALCWGKGFSFTDGKAQNDVAFAIGSLARRFGREDDVRYLNFITGGRSRAQALL
DNDRRRPQTNTINNFAIAQETFIIQLMQSMLPQVGGSDGGWQEKAKAMIQAMVMALCYLCRREQRIMSQR
ILVDYLPLKKVAQLYCQAVDEHWHDDARLPLENYLNLLAGFDISQVCRPSEWAPEALQQHGYLIQQFTRM
LTLFNDTYGHVFAEGAGDVELRDCLHNDRIVVVLIPALELESEEAATLGRLYYAQMAMILSQDLGEKIEG
PASDILVIRKFKDRFPFLIIGDEIGATYTDKIGELATQIRSLGYGLFLAGQDLQRLIVAAGKKTGTLLAN
MGTRIAGTTVDPEETLQVFSKAGGREFRAEMAAVERREGVIDTDWGESDQLQLREHDRIDLSELQALRPG
EIVTLFKGEPVRGAALYIADHDKLTRKSLHINRFIEVPAPTPSEMWEMLPHSARKCWPSPSIVSHLRRIL
GGYRNTAFVRYSPEHMTLTDDVLCRLADEEDRMAYILDTPRTQRGVRLYQTALNALRDKSGTRGRYRAES
TQLRQHTLPADVLRHLVSD

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(437-555)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 104260..113996

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K62_RS27520 (I6K62_27525) 99834..100340 - 507 WP_031623797 helix-turn-helix domain-containing protein -
I6K62_RS27525 (I6K62_27530) 100610..102598 + 1989 WP_029074264 conjugal transfer protein TraG -
I6K62_RS27530 (I6K62_27535) 102609..103082 + 474 WP_029074263 hypothetical protein -
I6K62_RS27535 (I6K62_27540) 103159..103923 - 765 WP_158581548 alpha/beta fold hydrolase -
I6K62_RS27540 (I6K62_27545) 103991..104113 + 123 Protein_91 CopG family transcriptional regulator -
I6K62_RS27545 (I6K62_27550) 104260..105255 + 996 WP_029074262 P-type conjugative transfer ATPase TrbB virB11
I6K62_RS27550 (I6K62_27555) 105252..105584 + 333 WP_029074261 TrbC/VirB2 family protein virB2
I6K62_RS27555 (I6K62_27560) 105584..105865 + 282 WP_029074260 VirB3 family type IV secretion system protein virB3
I6K62_RS27560 (I6K62_27565) 105876..108368 + 2493 WP_029074259 conjugal transfer protein TrbE virb4
I6K62_RS27565 (I6K62_27570) 108365..109141 + 777 WP_029074258 P-type conjugative transfer protein TrbJ virB5
I6K62_RS27570 (I6K62_27575) 109156..109422 + 267 WP_031623918 putative entry exclusion protein TrbK-alt -
I6K62_RS27575 (I6K62_27580) 109425..110780 + 1356 WP_029074256 P-type conjugative transfer protein TrbL virB6
I6K62_RS27580 (I6K62_27585) 110777..111466 + 690 WP_031623919 conjugal transfer protein TrbF virB8
I6K62_RS27585 (I6K62_27590) 111472..111849 - 378 WP_029074878 nuclear transport factor 2 family protein -
I6K62_RS27590 (I6K62_27595) 111946..112863 + 918 WP_200523655 P-type conjugative transfer protein TrbG virB9
I6K62_RS27595 (I6K62_27600) 112860..113996 + 1137 WP_031623920 TrbI/VirB10 family protein virB10
I6K62_RS27600 (I6K62_27605) 113999..114220 + 222 WP_029074252 DUF2274 domain-containing protein -
I6K62_RS27605 (I6K62_27610) 114356..114673 + 318 WP_029074251 hypothetical protein -
I6K62_RS27610 (I6K62_27615) 114670..115023 + 354 WP_029074250 DUF6516 family protein -
I6K62_RS27615 (I6K62_27620) 115020..115418 + 399 WP_029074249 helix-turn-helix domain-containing protein -
I6K62_RS27620 (I6K62_27625) 115415..117061 + 1647 WP_031623921 recombinase family protein -
I6K62_RS27625 (I6K62_27630) 117042..117365 + 324 Protein_108 IS21 family transposase -
I6K62_RS27630 (I6K62_27635) 117352..118137 + 786 WP_000983249 IS21-like element IS1326 family helper ATPase IstB -

Region 2: 148748..184392

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K62_RS27810 (I6K62_27815) 144022..145011 + 990 WP_049593989 toxin co-regulated pilus biosynthesis Q family protein -
I6K62_RS27815 (I6K62_27820) 145014..145430 + 417 WP_049593988 type IV pilus biogenesis protein PilM -
I6K62_RS27820 (I6K62_27825) 145459..147105 + 1647 WP_053094426 PilN family type IVB pilus formation outer membrane protein -
I6K62_RS27825 (I6K62_27830) 147117..148349 + 1233 WP_049593987 type 4b pilus protein PilO2 -
I6K62_RS27830 (I6K62_27835) 148333..148755 + 423 WP_049593986 type IV pilus biogenesis protein PilP -
I6K62_RS27835 (I6K62_27840) 148748..150268 + 1521 WP_049593985 GspE/PulE family protein virB11
I6K62_RS27840 (I6K62_27845) 150261..151337 + 1077 WP_049593984 type II secretion system F family protein -
I6K62_RS27845 (I6K62_27850) 151392..151982 + 591 WP_077260796 type 4 pilus major pilin -
I6K62_RS27850 (I6K62_27855) 152029..152529 + 501 WP_049593983 lytic transglycosylase domain-containing protein virB1
I6K62_RS27855 (I6K62_27860) 152519..153145 + 627 WP_049593982 prepilin peptidase -
I6K62_RS27860 (I6K62_27865) 153166..154632 + 1467 WP_023321932 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
I6K62_RS27865 (I6K62_27870) 155484..156602 + 1119 WP_049593981 site-specific integrase -
I6K62_RS27870 (I6K62_27875) 156676..157191 + 516 WP_148677624 hypothetical protein -
I6K62_RS27875 (I6K62_27880) 157181..157651 + 471 WP_049593979 lytic transglycosylase domain-containing protein virB1
I6K62_RS27880 (I6K62_27885) 157661..158119 + 459 WP_049593978 DotD/TraH family lipoprotein -
I6K62_RS27885 (I6K62_27890) 158116..158892 + 777 WP_049593977 type IV secretory system conjugative DNA transfer family protein traI
I6K62_RS27890 (I6K62_27895) 159127..160029 + 903 WP_049593976 GNAT family N-acetyltransferase -
I6K62_RS27895 (I6K62_27900) 160099..160935 - 837 WP_049593975 alpha/beta fold hydrolase -
I6K62_RS27900 (I6K62_27905) 161177..162331 + 1155 WP_049593974 plasmid transfer ATPase TraJ virB11
I6K62_RS27905 (I6K62_27910) 162328..162591 + 264 WP_049593973 hypothetical protein traK
I6K62_RS27910 (I6K62_27915) 162610..165735 + 3126 WP_049593972 LPD7 domain-containing protein -
I6K62_RS27915 (I6K62_27920) 165746..166093 + 348 WP_049593971 hypothetical protein traL
I6K62_RS27920 (I6K62_27925) 166110..166793 + 684 WP_023321918 DotI/IcmL/TraM family protein traM
I6K62_RS27925 (I6K62_27930) 166802..167794 + 993 WP_049593970 DotH/IcmK family type IV secretion protein traN
I6K62_RS27930 (I6K62_27935) 167800..169059 + 1260 WP_049593969 conjugal transfer protein TraO traO
I6K62_RS27935 (I6K62_27940) 169056..169820 + 765 WP_049593968 hypothetical protein traP
I6K62_RS27940 (I6K62_27945) 169830..170357 + 528 WP_023321914 conjugal transfer protein TraQ traQ
I6K62_RS27945 (I6K62_27950) 170403..170819 + 417 WP_049593967 DUF6750 family protein traR
I6K62_RS27950 (I6K62_27955) 170816..171322 + 507 WP_049593966 hypothetical protein traT
I6K62_RS27955 (I6K62_27960) 171378..174428 + 3051 WP_049593965 conjugal transfer protein traU
I6K62_RS27960 (I6K62_27965) 174489..175676 + 1188 WP_049593964 conjugal transfer protein TraW traW
I6K62_RS27965 (I6K62_27970) 175666..176193 + 528 WP_049593963 conjugal transfer protein TraX -
I6K62_RS28535 176564..176623 + 60 Protein_178 DinQ-like type I toxin DqlB -
I6K62_RS28540 177277..177372 + 96 WP_275955679 DinQ-like type I toxin DqlB -
I6K62_RS27970 (I6K62_27975) 177509..179656 + 2148 WP_049593962 DotA/TraY family protein traY
I6K62_RS27975 (I6K62_27980) 179765..180358 + 594 WP_148677622 plasmid IncI1-type surface exclusion protein ExcA -
I6K62_RS27980 (I6K62_27985) 181019..181765 + 747 WP_049593960 cyclopropane-fatty-acyl-phospholipid synthase family protein -
I6K62_RS27985 (I6K62_27990) 182416..183543 + 1128 WP_053094425 hypothetical protein trbA
I6K62_RS27990 (I6K62_27995) 183562..184392 + 831 WP_049593959 thioredoxin fold domain-containing protein trbB
I6K62_RS27995 (I6K62_28000) 184385..186544 + 2160 WP_049593958 F-type conjugative transfer protein TrbC -
I6K62_RS28000 (I6K62_28005) 186554..187063 + 510 WP_049593957 phospholipase D family protein -
I6K62_RS28005 (I6K62_28010) 187168..187602 + 435 WP_049593956 VOC family protein -
I6K62_RS28400 187630..187802 + 173 Protein_188 hypothetical protein -
I6K62_RS28010 (I6K62_28015) 187957..189387 - 1431 WP_049593955 aspartyl protease family protein -

Host bacterium

ID   18407 GenBank   NZ_CP069944
Plasmid name   FDAARGOS_1332|unnamed1 Incompatibility group   IncFIB
Plasmid size   216716 bp Coordinate of oriT [Strand]   203309..203390 [-]
Host baterium   Klebsiella oxytoca strain FDAARGOS_1332

Cargo genes

Drug resistance gene   floR, tet(G), sul1, qacE, ant(3'')-Ia
Virulence gene   -
Metal resistance gene   arsR, arsD, arsA, arsB, arsC, pcoE, pcoS, pcoR, pcoD, pcoC, pcoB, pcoA, silP, silA, silB, silF, silC, silR, silS, silE, merE, merD, merB, merR2, merA, merP, merT, merR1
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -