Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   117843
Name   oriT_FDAARGOS 1432|unnamed2 in_silico
Organism   Enterobacter asburiae strain FDAARGOS 1432
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP077412 (1582..1630 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_FDAARGOS 1432|unnamed2
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   6535 GenBank   WP_001568107
Name   WP_001568107_FDAARGOS 1432|unnamed2 insolico UniProt ID   _
Length   128 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 128 a.a.        Molecular weight: 14784.78 Da        Isoelectric Point: 4.6362

>WP_001568107.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MARVQAYPSDEVVDKINAIVEKRRAEGAKEKDISFSSVATMLLELGLRVYEAQMERKESGFNQKEFNKVL
LENVMKTQFTISKVLAMDSLSPHINGDDRFDFKSMVMNIRDDAREVVERFFPSQDEEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure



No available structure.




T4CP

ID   13246 GenBank   WP_023332870
Name   traD_I6L62_RS22935_FDAARGOS 1432|unnamed2 insolico UniProt ID   _
Length   735 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 735 a.a.        Molecular weight: 82700.58 Da        Isoelectric Point: 5.9222

>WP_023332870.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIASMRFRMFGQIANIILYVLFLFFWVLCGLILMYRLSWQTFVNGAVYWWCTTLGPMR
DIIRSQPVYTINYYGQQLQYTSEQILKDKYTIWCGEQLWTGFVFAGTVSLIICIVAFFVASWVLGHQGKQ
QSEDEVTGGRQLSEKPKEVARKMKRDGMASDIKIGDLPILLNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSIDKILNPLDSRCAAWDLWKECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRSVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKGIA
EFAAGEIGEKEIKKASENYSYGADPVRDGVSTGKEQKRETIVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRQLNQAIDDKLAAVLAAREAEGQSARILFMPDPVETVPVEKTDEKPASPVAAVPTP
QEDKAKVPPVTASNTFHKPASAAAAAASASVTQAGGVEQELHEKPEEQLPLPPGVNKDGEIEDMNAWDEW
QSSSDVLRDMHRREEVNINHSHHVDRDDINLGSNF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 94531..117150

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6L62_RS22935 (I6L62_22935) 94531..96738 - 2208 WP_023332870 type IV conjugative transfer system coupling protein TraD virb4
I6L62_RS22940 (I6L62_22940) 96923..97654 - 732 WP_001568076 conjugal transfer complement resistance protein TraT -
I6L62_RS22945 (I6L62_22945) 97832..98359 - 528 WP_024191983 conjugal transfer protein TraS -
I6L62_RS22950 (I6L62_22950) 98365..101214 - 2850 WP_001568078 conjugal transfer mating-pair stabilization protein TraG traG
I6L62_RS22955 (I6L62_22955) 101214..102584 - 1371 WP_023332869 conjugal transfer pilus assembly protein TraH traH
I6L62_RS22960 (I6L62_22960) 102571..103107 - 537 WP_032160235 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
I6L62_RS22965 (I6L62_22965) 103127..103360 - 234 WP_001568081 type-F conjugative transfer system pilin chaperone TraQ -
I6L62_RS22970 (I6L62_22970) 103371..104120 - 750 WP_001568082 type-F conjugative transfer system pilin assembly protein TraF traF
I6L62_RS22975 (I6L62_22975) 104136..104468 - 333 WP_001568083 hypothetical protein -
I6L62_RS22980 (I6L62_22980) 104465..104725 - 261 WP_001568084 conjugal transfer protein TrbE -
I6L62_RS22985 (I6L62_22985) 104738..106630 - 1893 WP_001568085 type-F conjugative transfer system mating-pair stabilization protein TraN traN
I6L62_RS22990 (I6L62_22990) 106627..107253 - 627 WP_001568086 type-F conjugative transfer system pilin assembly protein TrbC trbC
I6L62_RS22995 (I6L62_22995) 107266..108258 - 993 WP_199009169 conjugal transfer pilus assembly protein TraU traU
I6L62_RS23000 (I6L62_23000) 108269..108898 - 630 WP_023332867 type-F conjugative transfer system protein TraW traW
I6L62_RS23005 (I6L62_23005) 108895..109272 - 378 WP_001568089 type-F conjugative transfer system protein TrbI -
I6L62_RS23010 (I6L62_23010) 109272..111911 - 2640 WP_001568090 type IV secretion system protein TraC virb4
I6L62_RS23015 (I6L62_23015) 112374..112772 - 399 WP_001568092 hypothetical protein -
I6L62_RS23670 112777..113148 - 372 WP_223861966 hypothetical protein -
I6L62_RS23025 (I6L62_23025) 113304..113873 - 570 WP_001568094 type IV conjugative transfer system lipoprotein TraV traV
I6L62_RS23030 (I6L62_23030) 113892..114128 - 237 WP_001568098 hypothetical protein virb4
I6L62_RS23035 (I6L62_23035) 114121..115533 - 1413 WP_001568100 F-type conjugal transfer pilus assembly protein TraB traB
I6L62_RS23040 (I6L62_23040) 115533..116273 - 741 WP_001568101 type-F conjugative transfer system secretin TraK traK
I6L62_RS23045 (I6L62_23045) 116260..116826 - 567 WP_001568102 type IV conjugative transfer system protein TraE traE
I6L62_RS23050 (I6L62_23050) 116845..117150 - 306 WP_024191986 type IV conjugative transfer system protein TraL traL
I6L62_RS23055 (I6L62_23055) 117164..117532 - 369 WP_001568104 type IV conjugative transfer system pilin TraA -
I6L62_RS23060 (I6L62_23060) 117612..117980 - 369 WP_001568105 type IV conjugative transfer system pilin TraA -
I6L62_RS23065 (I6L62_23065) 118059..118223 - 165 WP_071594636 TraY domain-containing protein -

Host bacterium

ID   18276 GenBank   NZ_CP077412
Plasmid name   FDAARGOS 1432|unnamed2 Incompatibility group   IncFIA
Plasmid size   118412 bp Coordinate of oriT [Strand]   1582..1630 [+]
Host baterium   Enterobacter asburiae strain FDAARGOS 1432

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   ncrA, ncrB, ncrC, ncrY
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -