Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 117822 |
| Name | oriT_pEA-3 |
| Organism | Escherichia albertii strain ChinaSP140150 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP025679 (16752..16804 [+], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pEA-3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 13233 | GenBank | WP_233707893 |
| Name | t4cp2_C0R48_RS26860_pEA-3 |
UniProt ID | _ |
| Length | 547 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 547 a.a. Molecular weight: 61701.84 Da Isoelectric Point: 8.9172
>WP_233707893.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Escherichia]
MDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQFIYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSM
VILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAETIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKI
AAILIPASDDPIWSDSARNLFVGLGLYLLDKERFHLDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAW
MGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKTNFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSI
YLGLTPDALITHEKIVNLFFSLLVNENCRELPEHNPDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNL
RFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLYYPPKSKNALAKKISEEIGVRDMKISKRSISSGGGK
GGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNIAIREIITSEFSRPFIANKIIWFEEPEFKRRVDIAR
NNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVMVAGGNVITNPDLDNHDKTDVSE
MDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQFIYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSM
VILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAETIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKI
AAILIPASDDPIWSDSARNLFVGLGLYLLDKERFHLDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAW
MGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKTNFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSI
YLGLTPDALITHEKIVNLFFSLLVNENCRELPEHNPDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNL
RFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLYYPPKSKNALAKKISEEIGVRDMKISKRSISSGGGK
GGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNIAIREIITSEFSRPFIANKIIWFEEPEFKRRVDIAR
NNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVMVAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 35529..65805
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C0R48_RS26715 | 31675..32127 | + | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
| C0R48_RS26720 | 32120..32335 | + | 216 | WP_001127357 | DUF1187 family protein | - |
| C0R48_RS27420 | 32328..32504 | + | 177 | WP_000753050 | hypothetical protein | - |
| C0R48_RS26725 | 32531..33484 | + | 954 | WP_072109880 | SPFH domain-containing protein | - |
| C0R48_RS26735 | 33858..34301 | + | 444 | WP_072037179 | NfeD family protein | - |
| C0R48_RS27425 | 34305..34475 | + | 171 | WP_000550720 | hypothetical protein | - |
| C0R48_RS26740 | 34486..34698 | + | 213 | WP_039022940 | hypothetical protein | - |
| C0R48_RS26750 | 34969..35271 | + | 303 | WP_001360345 | hypothetical protein | - |
| C0R48_RS26755 | 35268..35525 | + | 258 | WP_000739144 | hypothetical protein | - |
| C0R48_RS26760 | 35529..36524 | + | 996 | WP_001028541 | type IV secretion system protein | virB6 |
| C0R48_RS26765 | 36530..37174 | + | 645 | WP_001310442 | type IV secretion system protein | - |
| C0R48_RS26770 | 37183..37407 | + | 225 | WP_000713561 | EexN family lipoprotein | - |
| C0R48_RS26775 | 37662..38453 | - | 792 | WP_023154636 | DUF5710 domain-containing protein | - |
| C0R48_RS26780 | 38501..39136 | + | 636 | WP_015059536 | hypothetical protein | - |
| C0R48_RS26785 | 39236..39487 | + | 252 | WP_000121741 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| C0R48_RS26790 | 39477..39758 | + | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| C0R48_RS26795 | 39826..40125 | + | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| C0R48_RS26800 | 40128..41363 | + | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| C0R48_RS26805 | 41369..41806 | + | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| C0R48_RS26810 | 41925..42323 | + | 399 | WP_001153665 | hypothetical protein | - |
| C0R48_RS26815 | 42344..42928 | + | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| C0R48_RS27890 | 42928..43218 | + | 291 | WP_000865479 | conjugal transfer protein | - |
| C0R48_RS26825 | 43289..43609 | + | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| C0R48_RS26830 | 43615..45972 | + | 2358 | WP_000548955 | VirB4 family type IV secretion system protein | virb4 |
| C0R48_RS26840 | 46138..46872 | + | 735 | WP_000432282 | virB8 family protein | virB8 |
| C0R48_RS26845 | 46938..47639 | + | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
| C0R48_RS26850 | 47629..48768 | + | 1140 | WP_000790640 | TrbI/VirB10 family protein | virB10 |
| C0R48_RS26855 | 48787..49842 | + | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| C0R48_RS26860 | 50172..51815 | + | 1644 | WP_233707893 | type IV secretory system conjugative DNA transfer family protein | - |
| C0R48_RS26865 | 51862..52398 | + | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
| C0R48_RS26870 | 52391..54034 | + | 1644 | WP_001035588 | PilN family type IVB pilus formation outer membrane protein | - |
| C0R48_RS26875 | 54085..55395 | + | 1311 | WP_227200640 | type 4b pilus protein PilO2 | - |
| C0R48_RS26880 | 55379..55873 | + | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| C0R48_RS26885 | 55898..57436 | + | 1539 | WP_000466227 | GspE/PulE family protein | virB11 |
| C0R48_RS26890 | 57427..58536 | + | 1110 | WP_000974902 | type II secretion system F family protein | - |
| C0R48_RS27895 | 58581..58886 | + | 306 | WP_233707884 | hypothetical protein | - |
| C0R48_RS27900 | 58883..59137 | + | 255 | WP_233707885 | type 4 pilus major pilin | - |
| C0R48_RS26900 | 59204..59686 | + | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| C0R48_RS26905 | 59690..60325 | + | 636 | WP_000934978 | A24 family peptidase | - |
| C0R48_RS26910 | 60338..61465 | + | 1128 | WP_233707886 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| C0R48_RS26920 | 61672..62001 | + | 330 | WP_233707894 | type IV pilus biogenesis protein PilP | - |
| C0R48_RS27905 | 62349..62630 | + | 282 | WP_233707887 | hypothetical protein | - |
| C0R48_RS27980 | 62609..62776 | + | 168 | WP_265093808 | ATPase, T2SS/T4P/T4SS family | - |
| C0R48_RS27985 | 62829..63191 | + | 363 | WP_265093809 | GspE family protein | virB11 |
| C0R48_RS27915 | 63208..63462 | + | 255 | WP_233707888 | hypothetical protein | - |
| C0R48_RS27920 | 63956..64432 | + | 477 | WP_233707889 | type II secretion system F family protein | - |
| C0R48_RS26935 | 64789..65256 | + | 468 | WP_064734747 | type 4 pilus major pilin | - |
| C0R48_RS26940 | 65323..65805 | + | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| C0R48_RS26945 | 65841..66440 | + | 600 | WP_233707890 | A24 family peptidase | - |
| C0R48_RS26950 | 66453..67482 | + | 1030 | Protein_86 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
Host bacterium
| ID | 18255 | GenBank | NZ_CP025679 |
| Plasmid name | pEA-3 | Incompatibility group | IncI2 |
| Plasmid size | 68747 bp | Coordinate of oriT [Strand] | 16752..16804 [+] |
| Host baterium | Escherichia albertii strain ChinaSP140150 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |