Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 117765 |
| Name | oriT_pPinheadLarry_03  |
| Organism | Klebsiella quasipneumoniae strain Pinhead Larry |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP065470 (73615..73664 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pPinheadLarry_03
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 13187 | GenBank | WP_227667373 |
| Name | traD_I5M56_RS25390_pPinheadLarry_03 |
UniProt ID | _ |
| Length | 769 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85879.90 Da Isoelectric Point: 5.1165
>WP_227667373.1 type IV conjugative transfer system coupling protein TraD [Klebsiella quasipneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTVWCGEQLWTSIVFAAVVSLVICIVTFFIASWVLGRRGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRRLDTRVDARLSALLEAREAEGSLARTLFMPDAPASGPADTNSHAGEQPEPISQPA
PADMTVSPAPVKAPPTTKSPAAEPSVRATEPPVLRVTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTVWCGEQLWTSIVFAAVVSLVICIVTFFIASWVLGRRGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRRLDTRVDARLSALLEAREAEGSLARTLFMPDAPASGPADTNSHAGEQPEPISQPA
PADMTVSPAPVKAPPTTKSPAAEPSVRATEPPVLRVTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 45977..74222
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I5M56_RS25390 (I5M56_25390) | 45977..48286 | - | 2310 | WP_227667373 | type IV conjugative transfer system coupling protein TraD | virb4 |
| I5M56_RS25395 (I5M56_25395) | 48645..49376 | - | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| I5M56_RS25400 (I5M56_25400) | 49566..50093 | - | 528 | WP_016528837 | conjugal transfer entry exclusion protein TraS | - |
| I5M56_RS25405 (I5M56_25405) | 50099..52948 | - | 2850 | WP_129073754 | conjugal transfer mating-pair stabilization protein TraG | traG |
| I5M56_RS25410 (I5M56_25410) | 52948..54327 | - | 1380 | WP_011977731 | conjugal transfer pilus assembly protein TraH | traH |
| I5M56_RS25415 (I5M56_25415) | 54305..54748 | - | 444 | WP_015065638 | F-type conjugal transfer protein TrbF | - |
| I5M56_RS25420 (I5M56_25420) | 54793..55350 | - | 558 | WP_004152678 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| I5M56_RS25425 (I5M56_25425) | 55322..55561 | - | 240 | WP_094716528 | type-F conjugative transfer system pilin chaperone TraQ | - |
| I5M56_RS25430 (I5M56_25430) | 55572..56324 | - | 753 | WP_015065637 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| I5M56_RS25435 (I5M56_25435) | 56345..56671 | - | 327 | WP_016529362 | hypothetical protein | - |
| I5M56_RS26900 | 56717..56902 | - | 186 | WP_032446653 | hypothetical protein | - |
| I5M56_RS25440 (I5M56_25440) | 56899..57135 | - | 237 | WP_016529263 | conjugal transfer protein TrbE | - |
| I5M56_RS25445 (I5M56_25445) | 57167..59122 | - | 1956 | WP_046041928 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| I5M56_RS25450 (I5M56_25450) | 59181..59819 | - | 639 | WP_015065635 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| I5M56_RS25455 (I5M56_25455) | 59832..60791 | - | 960 | WP_015065634 | conjugal transfer pilus assembly protein TraU | traU |
| I5M56_RS25460 (I5M56_25460) | 60835..61461 | - | 627 | WP_065810625 | type-F conjugative transfer system protein TraW | traW |
| I5M56_RS25465 (I5M56_25465) | 61461..61850 | - | 390 | WP_004152591 | type-F conjugative transfer system protein TrbI | - |
| I5M56_RS25470 (I5M56_25470) | 61850..64489 | - | 2640 | WP_016528865 | type IV secretion system protein TraC | virb4 |
| I5M56_RS25475 (I5M56_25475) | 64561..64959 | - | 399 | WP_015065631 | hypothetical protein | - |
| I5M56_RS25480 (I5M56_25480) | 64984..65388 | - | 405 | WP_023320104 | hypothetical protein | - |
| I5M56_RS25485 (I5M56_25485) | 65455..65772 | - | 318 | WP_094716526 | hypothetical protein | - |
| I5M56_RS25490 (I5M56_25490) | 65773..65991 | - | 219 | WP_004171484 | hypothetical protein | - |
| I5M56_RS25495 (I5M56_25495) | 66015..66305 | - | 291 | WP_032426790 | hypothetical protein | - |
| I5M56_RS26675 | 66334..66732 | - | 399 | WP_223177007 | hypothetical protein | - |
| I5M56_RS25505 (I5M56_25505) | 66888..67457 | - | 570 | WP_015065628 | type IV conjugative transfer system lipoprotein TraV | traV |
| I5M56_RS25510 (I5M56_25510) | 67669..68082 | - | 414 | Protein_79 | conjugal transfer pilus-stabilizing protein TraP | - |
| I5M56_RS25515 (I5M56_25515) | 68075..69499 | - | 1425 | WP_016529134 | F-type conjugal transfer pilus assembly protein TraB | traB |
| I5M56_RS25520 (I5M56_25520) | 69499..70239 | - | 741 | WP_004152497 | type-F conjugative transfer system secretin TraK | traK |
| I5M56_RS25525 (I5M56_25525) | 70226..70792 | - | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
| I5M56_RS25530 (I5M56_25530) | 70812..71117 | - | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| I5M56_RS25535 (I5M56_25535) | 71131..71499 | - | 369 | WP_004178060 | type IV conjugative transfer system pilin TraA | - |
| I5M56_RS25540 (I5M56_25540) | 71553..71924 | - | 372 | WP_004208838 | TraY domain-containing protein | - |
| I5M56_RS25545 (I5M56_25545) | 72008..72703 | - | 696 | WP_015065624 | transcriptional regulator TraJ family protein | - |
| I5M56_RS25550 (I5M56_25550) | 72910..73302 | - | 393 | WP_004206766 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| I5M56_RS25555 (I5M56_25555) | 73737..74222 | + | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
| I5M56_RS25560 (I5M56_25560) | 74255..74584 | - | 330 | WP_094716524 | DUF5983 family protein | - |
| I5M56_RS25565 (I5M56_25565) | 74617..75428 | - | 812 | Protein_90 | DUF932 domain-containing protein | - |
| I5M56_RS25570 (I5M56_25570) | 76262..76675 | - | 414 | WP_004182074 | type II toxin-antitoxin system HigA family antitoxin | - |
| I5M56_RS25575 (I5M56_25575) | 76676..76954 | - | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| I5M56_RS25580 (I5M56_25580) | 76944..77264 | - | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| I5M56_RS25585 (I5M56_25585) | 77345..77569 | - | 225 | WP_004152719 | hypothetical protein | - |
| I5M56_RS25590 (I5M56_25590) | 77580..77792 | - | 213 | WP_004152718 | hypothetical protein | - |
| I5M56_RS25595 (I5M56_25595) | 77853..78209 | - | 357 | WP_004152717 | hypothetical protein | - |
| I5M56_RS25600 (I5M56_25600) | 78845..79195 | - | 351 | WP_023320095 | hypothetical protein | - |
Host bacterium
| ID | 18198 | GenBank | NZ_CP065470 |
| Plasmid name | pPinheadLarry_03 | Incompatibility group | IncFII |
| Plasmid size | 148255 bp | Coordinate of oriT [Strand] | 73615..73664 [+] |
| Host baterium | Klebsiella quasipneumoniae strain Pinhead Larry |
Cargo genes
| Drug resistance gene | mph(A), aph(3')-Ia, sul2, floR, aac(3)-IId, blaTEM-1B, aph(6)-Id, qnrB4, blaDHA-1, tet(A), dfrA12, aadA2, qacE, sul1 |
| Virulence gene | - |
| Metal resistance gene | arsH, arsC, arsB, arsA, arsD, arsR |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |