Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   117592
Name   oriT_pWP3-S18-ESBL-03_1 in_silico
Organism   Klebsiella quasipneumoniae strain WP3-S18-ESBL-03
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_AP022015 (194964..195013 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pWP3-S18-ESBL-03_1
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   13097 GenBank   WP_182972076
Name   traD_H7R87_RS26490_pWP3-S18-ESBL-03_1 insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79641.24 Da        Isoelectric Point: 8.8191

>WP_182972076.1 conjugative transfer system coupling protein TraD [Klebsiella quasipneumoniae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSVYVLIDSWTSKYGISEIPFYCSLGLIAMACWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRIINNAHFFADDRKYQKLVNLQESGGAPSKNRVYKLFRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPITRHYRKLAFDLGGNYAIFGVDKKVPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQDGLKEECESLGKPFMHFHAGTPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFLRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGNDWHLTVQVSQNLALADEIDKLKEYFYCNYFEDNSPKNLHGMDTVLECFKYI
SGDEFHYYKITASLMPMLKRLSQTPMDILLSANDVANPNRNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSASTKQSHTNFNGSISERKST
TMVSSIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVVDMVMTSPYKLKLRRNLDVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-654)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 295313..320638

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H7R87_RS27500 (WP3S18E03_P13100) 290890..291654 - 765 WP_099745345 hypothetical protein -
H7R87_RS27505 (WP3S18E03_P13110) 291709..292377 - 669 WP_099745307 hypothetical protein -
H7R87_RS27510 (WP3S18E03_P13130) 292773..293881 + 1109 WP_182972068 IS3-like element ISKpn20 family transposase -
H7R87_RS27515 (WP3S18E03_P13160) 294843..295211 + 369 WP_072046247 pili assembly chaperone -
H7R87_RS27520 295313..295615 + 303 WP_099745306 type IV conjugative transfer system protein TraL traL
H7R87_RS27525 (WP3S18E03_P13170) 295634..296494 + 861 WP_182972069 TraE/TraK family type IV conjugative transfer system protein traE
H7R87_RS27530 (WP3S18E03_P13180) 296496..297665 + 1170 WP_099745304 type-F conjugative transfer system secretin TraK traK
H7R87_RS27540 (WP3S18E03_P13190) 297662..298180 + 519 WP_099745303 hypothetical protein -
H7R87_RS27545 (WP3S18E03_P13200) 298140..299513 + 1374 WP_176694865 TrbI/VirB10 family protein traB
H7R87_RS27550 (WP3S18E03_P13210) 299516..299980 + 465 WP_099745302 hypothetical protein -
H7R87_RS27555 (WP3S18E03_P13220) 299983..300834 + 852 WP_227666860 DsbC family protein -
H7R87_RS27560 (WP3S18E03_P13230) 300844..301581 + 738 WP_072046241 TraV family lipoprotein traV
H7R87_RS27565 (WP3S18E03_P13240) 301626..304343 + 2718 WP_099745300 TraC family protein virb4
H7R87_RS27570 304370..304786 - 417 WP_224459619 trhZ -
H7R87_RS27575 (WP3S18E03_P13250) 304758..305258 - 501 WP_099745299 hypothetical protein -
H7R87_RS27580 (WP3S18E03_P13260) 305245..305904 - 660 WP_227666861 hypothetical protein -
H7R87_RS27585 (WP3S18E03_P13270) 305951..306754 - 804 WP_182972070 metallophosphoesterase -
H7R87_RS27590 307440..307898 + 459 WP_032720872 hypothetical protein -
H7R87_RS27595 (WP3S18E03_P13280) 307984..308277 + 294 WP_182972083 hypothetical protein -
H7R87_RS27600 (WP3S18E03_P13290) 308265..308801 + 537 WP_099745295 plasmid transfer protein -
H7R87_RS27605 (WP3S18E03_P13300) 308929..313170 + 4242 WP_099745294 Ig-like domain-containing protein -
H7R87_RS27610 (WP3S18E03_P13310) 313308..313832 + 525 WP_072046231 signal peptidase I -
H7R87_RS27615 (WP3S18E03_P13320) 313819..315066 + 1248 WP_227666862 TrbC family F-type conjugative pilus assembly protein traW
H7R87_RS27625 (WP3S18E03_P13350) 316409..317446 + 1038 WP_004026524 IncHI-type conjugal transfer protein TrhU traU
H7R87_RS27630 (WP3S18E03_P13360) 317456..320638 + 3183 WP_099745292 conjugal transfer protein TraN traN
H7R87_RS27635 (WP3S18E03_P13370) 320668..321519 - 852 WP_099745291 hypothetical protein -
H7R87_RS27640 (WP3S18E03_P13380) 321800..323599 + 1800 WP_099745290 ATP-dependent helicase -
H7R87_RS27645 (WP3S18E03_P13390) 323932..324909 + 978 WP_182972071 hypothetical protein -
H7R87_RS27650 (WP3S18E03_P13400) 325054..325407 + 354 WP_072046272 hypothetical protein -

Host bacterium

ID   18025 GenBank   NZ_AP022015
Plasmid name   pWP3-S18-ESBL-03_1 Incompatibility group   IncFIB
Plasmid size   346351 bp Coordinate of oriT [Strand]   194964..195013 [+]
Host baterium   Klebsiella quasipneumoniae strain WP3-S18-ESBL-03

Cargo genes

Drug resistance gene   -
Virulence gene   pla
Metal resistance gene   merE, merD, merA, merF, merP, merT, merR2, terW, terZ, terA, terB, terC, terD, terE, arsB, arsA, arsD, arsR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9