Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   117402
Name   oriT_p13450-2 in_silico
Organism   Klebsiella variicola strain 13450
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP026016 (11576..11625 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_p13450-2
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   12949 GenBank   WP_060598860
Name   traD_C2D62_RS28840_p13450-2 insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 85363.18 Da        Isoelectric Point: 4.9167

>WP_060598860.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 14083..41724

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C2D62_RS28645 (C2D62_29860) 10456..10986 + 531 WP_077138878 antirestriction protein -
C2D62_RS28650 (C2D62_29865) 11024..11431 - 408 WP_224230374 transglycosylase SLT domain-containing protein -
C2D62_RS28655 (C2D62_29870) 11925..12323 + 399 WP_060598876 conjugal transfer relaxosome DNA-binding protein TraM -
C2D62_RS28660 (C2D62_29875) 12496..13182 + 687 WP_060598875 transcriptional regulator TraJ family protein -
C2D62_RS28665 (C2D62_29880) 13261..13647 + 387 WP_004152495 TraY domain-containing protein -
C2D62_RS28670 (C2D62_29885) 13701..14069 + 369 WP_049155512 type IV conjugative transfer system pilin TraA -
C2D62_RS28675 (C2D62_29890) 14083..14388 + 306 WP_004178059 type IV conjugative transfer system protein TraL traL
C2D62_RS28680 (C2D62_29895) 14408..14974 + 567 WP_153242763 type IV conjugative transfer system protein TraE traE
C2D62_RS28685 (C2D62_29900) 14961..15701 + 741 WP_023340945 type-F conjugative transfer system secretin TraK traK
C2D62_RS28690 (C2D62_29905) 15701..17125 + 1425 WP_153242766 F-type conjugal transfer pilus assembly protein TraB traB
C2D62_RS28695 (C2D62_29910) 17118..17714 + 597 WP_060598872 conjugal transfer pilus-stabilizing protein TraP -
C2D62_RS28700 (C2D62_29915) 17737..18321 + 585 WP_060598871 type IV conjugative transfer system lipoprotein TraV traV
C2D62_RS28705 (C2D62_29920) 18453..18863 + 411 WP_060598870 hypothetical protein -
C2D62_RS28710 (C2D62_29925) 18868..19152 + 285 WP_153242804 hypothetical protein -
C2D62_RS28715 (C2D62_29930) 19176..19400 + 225 WP_060598869 hypothetical protein -
C2D62_RS28720 (C2D62_29935) 19393..19704 + 312 WP_077138882 hypothetical protein -
C2D62_RS28725 (C2D62_29940) 19771..20175 + 405 WP_060598867 hypothetical protein -
C2D62_RS28730 (C2D62_29945) 20218..20541 + 324 WP_072124277 hypothetical protein -
C2D62_RS28735 (C2D62_29950) 20549..20947 + 399 WP_164876867 hypothetical protein -
C2D62_RS28740 (C2D62_29955) 21019..23658 + 2640 WP_153242768 type IV secretion system protein TraC virb4
C2D62_RS28745 (C2D62_29960) 23658..24047 + 390 WP_020803372 type-F conjugative transfer system protein TrbI -
C2D62_RS28750 (C2D62_29965) 24047..24673 + 627 WP_020314628 type-F conjugative transfer system protein TraW traW
C2D62_RS28755 (C2D62_29970) 24717..25676 + 960 WP_029497356 conjugal transfer pilus assembly protein TraU traU
C2D62_RS28760 (C2D62_29975) 25691..26239 + 549 WP_022631518 hypothetical protein -
C2D62_RS28765 (C2D62_29980) 26214..26903 - 690 WP_032427592 hypothetical protein -
C2D62_RS28770 (C2D62_29985) 26960..27562 + 603 WP_077138883 hypothetical protein -
C2D62_RS28775 (C2D62_29990) 27707..28354 + 648 WP_039698503 type-F conjugative transfer system pilin assembly protein TrbC trbC
C2D62_RS28780 (C2D62_29995) 28413..30368 + 1956 WP_153242770 type-F conjugative transfer system mating-pair stabilization protein TraN traN
C2D62_RS28785 (C2D62_30000) 30401..30682 + 282 WP_022644736 hypothetical protein -
C2D62_RS28790 (C2D62_30005) 30672..30899 + 228 WP_153242772 conjugal transfer protein TrbE -
C2D62_RS28795 (C2D62_30010) 30910..31236 + 327 WP_012539967 hypothetical protein -
C2D62_RS28800 (C2D62_30015) 31257..32009 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
C2D62_RS28805 (C2D62_30020) 32020..32259 + 240 WP_023340931 type-F conjugative transfer system pilin chaperone TraQ -
C2D62_RS28810 (C2D62_30025) 32231..32788 + 558 WP_032433944 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
C2D62_RS28815 (C2D62_30030) 32834..33277 + 444 WP_040172400 F-type conjugal transfer protein TrbF -
C2D62_RS28820 (C2D62_30035) 33255..34634 + 1380 WP_072198238 conjugal transfer pilus assembly protein TraH traH
C2D62_RS28825 (C2D62_30040) 34634..37456 + 2823 WP_153242774 conjugal transfer mating-pair stabilization protein TraG traG
C2D62_RS28830 37480..38082 + 603 WP_048263624 hypothetical protein -
C2D62_RS28835 (C2D62_30045) 38333..39064 + 732 WP_016831056 conjugal transfer complement resistance protein TraT -
C2D62_RS28840 (C2D62_30050) 39424..41724 + 2301 WP_060598860 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   17835 GenBank   NZ_CP026016
Plasmid name   p13450-2 Incompatibility group   IncFII
Plasmid size   109205 bp Coordinate of oriT [Strand]   11576..11625 [-]
Host baterium   Klebsiella variicola strain 13450

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -