Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 117150 |
| Name | oriT_pBE5_3  |
| Organism | Enterococcus faecalis strain BE5 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP110077 (6941..6976 [+], 36 nt) |
| oriT length | 36 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 36 nt
>oriT_pBE5_3
ACCACCCAATTTTGGAGTGGTGTGTAAGTGCGCATT
ACCACCCAATTTTGGAGTGGTGTGTAAGTGCGCATT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 10921 | GenBank | WP_229236143 |
| Name | Mob_Pre_OLM06_RS14970_pBE5_3 |
UniProt ID | _ |
| Length | 41 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 41 a.a. Molecular weight: 5019.54 Da Isoelectric Point: 8.4734
>WP_229236143.1 MULTISPECIES: plasmid recombination protein [Lactobacillales]
MSRSHLNYDLVDRTYNYKTDIERYINENKSSPRAIRNKDEL
MSRSHLNYDLVDRTYNYKTDIERYINENKSSPRAIRNKDEL
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
| ID | 17583 | GenBank | NZ_CP110077 |
| Plasmid name | pBE5_3 | Incompatibility group | - |
| Plasmid size | 13461 bp | Coordinate of oriT [Strand] | 6941..6976 [+] |
| Host baterium | Enterococcus faecalis strain BE5 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |