Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   116940
Name   oriT_Kluyvera georgiana|1 in_silico
Organism   Kluyvera georgiana isolate Kluyvera georgiana
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LR882926 (16817..16869 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_Kluyvera georgiana|1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   12632 GenBank   WP_015059539
Name   t4cp2_INS41_RS00255_Kluyvera georgiana|1 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 35997..58833

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
INS41_RS00185 31219..32343 - 1125 WP_000486716 site-specific integrase -
INS41_RS00190 32392..32700 + 309 WP_106508618 pilus assembly protein -
INS41_RS00195 33243..33398 - 156 WP_001358489 hypothetical protein -
INS41_RS00410 33754..33972 + 219 Protein_41 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
INS41_RS00205 33969..35345 - 1377 WP_000750519 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
INS41_RS00210 35358..35993 - 636 WP_000934977 A24 family peptidase -
INS41_RS00215 35997..36479 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
INS41_RS00220 36545..37108 - 564 WP_034169414 type 4 pilus major pilin -
INS41_RS00225 37158..38267 - 1110 WP_000974903 type II secretion system F family protein -
INS41_RS00230 38258..39796 - 1539 WP_000466225 GspE/PulE family protein virB11
INS41_RS00235 39821..40315 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
INS41_RS00240 40299..41621 - 1323 WP_000454142 type 4b pilus protein PilO2 -
INS41_RS00245 41660..43303 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
INS41_RS00250 43296..43838 - 543 WP_001220544 sigma 54-interacting transcriptional regulator virb4
INS41_RS00255 43885..45843 - 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
INS41_RS00260 45859..46914 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
INS41_RS00265 46933..48072 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
INS41_RS00270 48062..48763 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein virB9
INS41_RS00275 48829..49563 - 735 WP_000432282 virB8 family protein virB8
INS41_RS00280 49729..52086 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
INS41_RS00285 52092..52412 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
INS41_RS00405 52483..52773 - 291 WP_000865479 conjugal transfer protein -
INS41_RS00295 52773..53357 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
INS41_RS00300 53378..53776 - 399 WP_001153669 hypothetical protein -
INS41_RS00305 53895..54332 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
INS41_RS00310 54338..55573 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
INS41_RS00315 55576..55875 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
INS41_RS00320 55923..56732 + 810 WP_024237698 DUF5710 domain-containing protein -
INS41_RS00325 56955..57179 - 225 WP_000713562 EexN family lipoprotein -
INS41_RS00330 57188..57832 - 645 WP_001310442 type IV secretion system protein -
INS41_RS00335 57838..58833 - 996 WP_001028540 type IV secretion system protein virB6
INS41_RS00340 58837..59094 - 258 WP_000739144 hypothetical protein -
INS41_RS00345 59091..59444 - 354 WP_223286767 hypothetical protein -
INS41_RS00350 59664..60110 - 447 WP_001243165 hypothetical protein -
INS41_RS00355 60121..60291 - 171 WP_000550720 hypothetical protein -
INS41_RS00360 60295..60738 - 444 WP_000964330 NfeD family protein -
INS41_RS00365 61112..62065 - 954 WP_072089442 SPFH domain-containing protein -
INS41_RS00370 62092..62268 - 177 WP_000753050 hypothetical protein -
INS41_RS00375 62261..62476 - 216 WP_001127357 DUF1187 family protein -
INS41_RS00380 62469..62975 - 507 WP_001326595 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   17373 GenBank   NZ_LR882926
Plasmid name   Kluyvera georgiana|1 Incompatibility group   IncI2
Plasmid size   64053 bp Coordinate of oriT [Strand]   16817..16869 [-]
Host baterium   Kluyvera georgiana isolate Kluyvera georgiana

Cargo genes


Drug resistance gene   blaCTX-M-64, mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -