Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 116939
• Name: oriT_FDAARGOS_355|unnamed1
• Organism: Staphylococcus saprophyticus strain FDAARGOS_355
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CP022091 (30405..30423 [+], 19 nt)
• oriT length: 19 nt
• IRs (inverted repeats): _
• Location of nic site: 12..13
• Conserved sequence flanking the nic site: GTGCGCCCTT
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 19 nt

>oriT_FDAARGOS_355|unnamed1
CGCATAAGTGCGCCCTTAC

oriT secondary structure

Predicted by RNAfold.

Relaxase

Replic_Relax_CEQ33_RS00160_FDAARGOS_355|unnamed1

• ID: 10812
• GenBank: WP_011304031
• Name: Replic_Relax_CEQ33_RS00160_FDAARGOS_355|unnamed1
• UniProt ID: Q49UI1
• Length: 151 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 151 a.a.
• Molecular weight: 18095.03 Da
• Isoelectric Point: 9.8922

>WP_011304031.1 MULTISPECIES: MarR family transcriptional regulator [Staphylococcus]
MEHKEGNLEIIINQFYDATANINKAITNMVKELEPGRYLSYEQIETMYFIQHNEKVSINDLANKQRTYKT
AASKRVKKLESKGYVQRVYSNDKRTKLLSLTHNGERLLKEMKINLTKEIKLLLLSCFVREDFEKFMYQLM
NFEKTFLKKYY

Protein domains

Predicted by InterproScan.

• Winged helix DNA-binding domain (HTH_27) (39-104)

Protein structure

• AlphaFold DB: Q49UI1

Host bacterium

• ID: 17372
• GenBank: NZ_CP022091
• Plasmid name: FDAARGOS_355|unnamed1
• Incompatibility group: -
• Plasmid size: 38454 bp
• Coordinate of oriT [Strand]: 30405..30423 [+]
• Host baterium: Staphylococcus saprophyticus strain FDAARGOS_355

Cargo genes

• Drug resistance gene: -
• Virulence gene: -
• Metal resistance gene: arsR, arsB, arsC
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: AcrIIA21