Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 116932 |
| Name | oriT_pEC-NDM1-RUN  |
| Organism | Enterobacter cloacae strain coch4 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_MW464182 (127005..127155 [-], 151 nt) |
| oriT length | 151 nt |
| IRs (inverted repeats) | 93..98, 106..111 (TGGCCT..AGGCCA) 12..17, 24..29 (AACCCT..AGGGTT) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 151 nt
>oriT_pEC-NDM1-RUN
TGGTCGATGTGAACCCTTTCGACAGGGTTATGAATGAATTGAAAAGTCGTGGCCGCAAGAACGCTCACATCCTGAGCATCCTCCAATTCGACTGGCCTGCATCGGAGGCCATCATCGAGAAGCTGAGCTGCTACATCACAGACGGGATTAA
TGGTCGATGTGAACCCTTTCGACAGGGTTATGAATGAATTGAAAAGTCGTGGCCGCAAGAACGCTCACATCCTGAGCATCCTCCAATTCGACTGGCCTGCATCGGAGGCCATCATCGAGAAGCTGAGCTGCTACATCACAGACGGGATTAA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 10807 | GenBank | WP_264180104 |
| Name | mobH_LIX74_RS00815_pEC-NDM1-RUN |
UniProt ID | _ |
| Length | 626 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 626 a.a. Molecular weight: 70134.28 Da Isoelectric Point: 6.3044
>WP_264180104.1 MobH family relaxase [Enterobacter cloacae]
MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGSTESSKPD
AGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGTSTFRLTH
SAHRQRQPALTQQTQKSQMWQCPESKRSSQNRTSFHKNKTPCRAMTFQCSVVLMNRHHGRLSRSLC
MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGSTESSKPD
AGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGTSTFRLTH
SAHRQRQPALTQQTQKSQMWQCPESKRSSQNRTSFHKNKTPCRAMTFQCSVVLMNRHHGRLSRSLC
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 109706..126654
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIX74_RS00655 | 104737..105101 | - | 365 | Protein_130 | LuxR family transcriptional regulator | - |
| LIX74_RS00660 | 105358..105675 | + | 318 | WP_000118520 | quaternary ammonium compound efflux SMR transporter SugE | - |
| LIX74_RS00665 | 105672..106204 | - | 533 | Protein_132 | lipocalin family protein | - |
| LIX74_RS00670 | 106297..107441 | - | 1145 | Protein_133 | CMY-2 family class C beta-lactamase | - |
| LIX74_RS00675 | 107765..109027 | - | 1263 | WP_000608644 | IS1380-like element ISEcp1 family transposase | - |
| LIX74_RS00680 | 109268..109702 | - | 435 | WP_151392951 | TraA family conjugative transfer protein | - |
| LIX74_RS00685 | 109706..110284 | - | 579 | WP_000793435 | type IV conjugative transfer system lipoprotein TraV | traV |
| LIX74_RS00690 | 110281..110751 | - | 471 | Protein_137 | TraB/VirB10 family protein | - |
| LIX74_RS00695 | 110673..114914 | - | 4242 | Protein_138 | Ig-like domain-containing protein | - |
| LIX74_RS00700 | 115020..115384 | - | 365 | Protein_139 | LuxR family transcriptional regulator | - |
| LIX74_RS00705 | 115641..115958 | + | 318 | WP_000118520 | quaternary ammonium compound efflux SMR transporter SugE | - |
| LIX74_RS00710 | 115955..116486 | - | 532 | Protein_141 | lipocalin family protein | - |
| LIX74_RS00715 | 116579..117723 | - | 1145 | Protein_142 | CMY-2 family class C beta-lactamase | - |
| LIX74_RS00720 | 118047..119309 | - | 1263 | WP_000608644 | IS1380-like element ISEcp1 family transposase | - |
| LIX74_RS00725 | 119551..119985 | - | 435 | WP_151392951 | TraA family conjugative transfer protein | - |
| LIX74_RS00730 | 119989..120567 | - | 579 | WP_000793435 | type IV conjugative transfer system lipoprotein TraV | traV |
| LIX74_RS00735 | 120564..121211 | - | 648 | Protein_146 | TraB/VirB10 family protein | - |
| LIX74_RS00740 | 121271..121879 | - | 609 | WP_264180100 | hypothetical protein | traB |
| LIX74_RS00745 | 121876..122583 | - | 708 | WP_319003969 | type-F conjugative transfer system secretin TraK | traK |
| LIX74_RS00750 | 122571..122792 | - | 222 | WP_264180101 | hypothetical protein | - |
| LIX74_RS00755 | 122776..123402 | - | 627 | WP_001049717 | TraE/TraK family type IV conjugative transfer system protein | traE |
| LIX74_RS00760 | 123399..123678 | - | 280 | Protein_151 | type IV conjugative transfer system protein TraL | - |
| LIX74_RS00765 | 123822..124139 | - | 318 | WP_223847817 | hypothetical protein | - |
| LIX74_RS00770 | 124199..124342 | - | 144 | WP_001275801 | hypothetical protein | - |
| LIX74_RS00775 | 124523..125182 | - | 660 | WP_319003967 | hypothetical protein | - |
| LIX74_RS00780 | 125182..125559 | - | 378 | WP_000869297 | hypothetical protein | - |
| LIX74_RS00785 | 125569..126015 | - | 447 | WP_000122507 | hypothetical protein | - |
| LIX74_RS00790 | 126025..126654 | - | 630 | WP_000743449 | DUF4400 domain-containing protein | tfc7 |
| LIX74_RS00795 | 126611..127195 | - | 585 | WP_000332868 | hypothetical protein | - |
| LIX74_RS00800 | 127206..129068 | - | 1863 | Protein_159 | conjugative transfer system coupling protein TraD | - |
| LIX74_RS00805 | 129065..129325 | - | 261 | WP_264180102 | hypothetical protein | - |
| LIX74_RS00810 | 129375..130208 | - | 834 | WP_264180103 | hypothetical protein | - |
Host bacterium
| ID | 17365 | GenBank | NZ_MW464182 |
| Plasmid name | pEC-NDM1-RUN | Incompatibility group | IncA/C2 |
| Plasmid size | 147312 bp | Coordinate of oriT [Strand] | 127005..127155 [-] |
| Host baterium | Enterobacter cloacae strain coch4 |
Cargo genes
| Drug resistance gene | blaNDM-1, aac(6')-Ib, blaCMY-6 |
| Virulence gene | htpB |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |