Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 116925
• Name: oriT_pN20519NDM
• Organism: Enterobacter hormaechei subsp. steigerwaltii strain N20-00519
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_MW192782 (11801..11899 [-], 99 nt)
• oriT length: 99 nt
• IRs (inverted repeats): 77..82, 89..94 (AAAAAA..TTTTTT) 77..82, 88..93 (AAAAAA..TTTTTT) 31..38, 41..48 (AGCGTGAT..ATCACGCT) 17..23, 35..41 (TAAATCA..TGATTTA)
• Location of nic site: 59..60
• Conserved sequence flanking the nic site: GGTGTATAGC
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 99 nt

>oriT_pN20519NDM
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

oriT secondary structure

Predicted by RNAfold.

Relaxase

Replic_Relax_LIX65_RS00165_pN20519NDM

• ID: 10803
• GenBank: WP_000130000
• Name: Replic_Relax_LIX65_RS00165_pN20519NDM
• UniProt ID: R4WML4
• Length: 101 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 101 a.a.
• Molecular weight: 11477.11 Da
• Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

Protein domains

Predicted by InterproScan.

• Transcriptional regulator PadR-like family (PadR) (15-84)

Protein structure

• AlphaFold DB: R4WML4

Host bacterium

• ID: 17358
• GenBank: NZ_MW192782
• Plasmid name: pN20519NDM
• Incompatibility group: IncR
• Plasmid size: 44685 bp
• Coordinate of oriT [Strand]: 11801..11899 [-]
• Host baterium: Enterobacter hormaechei subsp. steigerwaltii strain N20-00519

Cargo genes

• Drug resistance gene: aac(6')-Ib-cr, blaOXA-1, catB3, ARR-3, qacE, sul1, blaNDM-1, blaOXA-10, ant(3'')-Ia, mph(A)
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -