Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   116882
Name   oriT_322|unnamed2 in_silico
Organism   Staphylococcus aureus strain 322
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP077909 (30369..30557 [+], 189 nt)
oriT length   189 nt
IRs (inverted repeats)      163..168, 178..183  (ATTTTA..TAAAAT)
 118..123, 130..135  (CCCCAT..ATGGGG)
 100..106, 110..116  (ATCTGGC..GCCAGAT)
 41..46, 48..53  (AAGTGT..ACACTT)
 31..39, 44..52  (AGTGTCACA..TGTGACACT)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 189 nt

>oriT_322|unnamed2
TGTCTTATTTTTGTGACAAATGCTGTATGTAGTGTCACAAAAGTGTGACACTTGAGCTTTTTATGACCCCACACAAAAACATTTTCGAAGCCTTGAAATATCTGGCTTTGCCAGATCCCCCATTCATTGATGGGGACAAATTTCCCTTATGCTCTTACGGAGATTTTAGAGTTAAATTAAAATTTCTAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   10773 GenBank   WP_263974819
Name   Mob_Pre_KU527_RS14190_322|unnamed2 insolico UniProt ID   _
Length   45 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 45 a.a.        Molecular weight: 5381.24 Da        Isoelectric Point: 10.6752

>WP_263974819.1 plasmid recombination protein [Staphylococcus aureus]
MSYSIIRVVKVKSKTNTRGIQRHIQRENKNYENIDIDLSKSYLKL

  Protein domains


Predicted by InterproScan.

(1-43)


  Protein structure



No available structure.




Host bacterium


ID   17315 GenBank   NZ_CP077909
Plasmid name   322|unnamed2 Incompatibility group   -
Plasmid size   46752 bp Coordinate of oriT [Strand]   30369..30557 [+]
Host baterium   Staphylococcus aureus strain 322

Cargo genes


Drug resistance gene   blaZ
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -