Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   116881
Name   oriT_FDAARGOS_1524|unnamed1 in_silico
Organism   Citrobacter werkmanii strain FDAARGOS_1524
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP084373 (55295..55377 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 83 nt

>oriT_FDAARGOS_1524|unnamed1
GGGACAGGATATGTTTTGTAGCACCGCCTGCACGCAGTCGGTCCCTACAAAACATCCTGGTCAGGGCGAAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   10772 GenBank   WP_042313701
Name   traI_LA356_RS23580_FDAARGOS_1524|unnamed1 insolico UniProt ID   _
Length   663 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 663 a.a.        Molecular weight: 75963.34 Da        Isoelectric Point: 6.0680

>WP_042313701.1 TraI/MobA(P) family conjugative relaxase [Citrobacter werkmanii]
MIAIVPEKRRDGKSSFLQLLSYLTLREDVRLAEPVSPDAPVMRMSRSKEAIFDRLVDYIDRSQDAVMQTP
VKEFADGRSQVLSGNVACETNCFSLDTASAEMNMVAAQNTRCVDPVYHFILSWPAQDNPVDADIFDCARS
AIQALGMKEHQFVTAIHRDTDHVHCHVAVNRINPISYRAANLYNDIDTLHKVCRFLELKYDYTPDNGVWV
NENGAVVRSKNDVKSIPRKARQLEYHSDKESLYSYAVNECRERIGEILGSGEASWETLHAELIRAGLEMR
EKGEGLAIYSRHDESVTPIKASTLHPDLTRQCLEKWLGDFEPSPEVVNHFDEDGVYLGSNYPQEFVYDAR
AHVRDQGARSERRLARAVAREDLDARYKAYKNAWVRPKMPDTDSGIQFKALSNRYAWKKEQVRYVFDDPL
IRKLIYRTLELERQKEFEMLRDKVKAEKSQFYSRPENRRLSYWQWVERQAAAQDQAAISRLRGRAYKLKQ
KQRTPGLSENAIVCAVADDIAAVNIDGFESRVNRDGVIQYLQDGHVVIQDSGERIEIADPYREEGIHISD
AMLIAEEKSGESLQFSGEGRFVNSACDVVQWFNDGGEKPLPLTDPQQRVMAGYDKPETHPDRPVMTHRIV
DEETYLASRQVARTGDEREIDELKPGKNTHRLR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(52-317)

Large polyvalent protein-associated domain 7 (LPD7)

(517-589)


  Protein structure



No available structure.




T4CP

ID   12586 GenBank   WP_052511208
Name   trbC_LA356_RS23640_FDAARGOS_1524|unnamed1 insolico UniProt ID   _
Length   731 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 731 a.a.        Molecular weight: 82978.45 Da        Isoelectric Point: 7.4741

>WP_052511208.1 F-type conjugative transfer protein TrbC [Citrobacter werkmanii]
MTTGNTQPVDKDRVRQITRSTWMDDYLLAPATVQAGLVVILVLTFLRTWILIPGVFATAIWLLTFFGQLF
RMPLRMPKDIGGIDMTTERENALEFKGPMGLFRFTRRRLTWDKSAGIMCLGHARRRFLGRELWLTRDDCL
RHMQLLATTGSGKTEALLSLQLNSLCMGRGMMFSDGKAETRLAYAIWSLMRRYGQEDNYYVLNFLNGGRD
RFDELLGNDRTRPQSNTINFFGDTTATFIIQLMESLLPQVGSNEAGWQDKAKPMLYGLVYALYYKCRKDN
IRLSQSIIQKHLPLKEMADLYIEAKQNGWHDEAVNALEAYLSNLAGFRMELVSKSSEWDQGVYDQHGFLT
QQFSRMLAMFNDVYGHIFSSDAGDIDISDVLHNDRTLVVLIPALELSKSESANLGKLYISAKRMVIARDL
GYQLEGKSRDVLTSKKFQNPFPFPDVHDELGSYFAPGMDDLAAQMRSLGIMLVISAQDIQRFVAQFKGEY
QTVNANTLVKWFMAMQDEKDTFELATATAGKDYFAELGEMKRTPGTVSSSYEEANTTYIREKNRITLDEL
KDLNPGEGFISFKSALVPSSAIYIPDDEKISSKLSLKINRFIDTGTPTEADLVAQNPYLKRLLPPSELEV
SMLLQRTDEIIAGSETHTLPPLMDPILARLMKVALDLDNRCDISYTPTQRGILLFEAARDVLKKRGKKWF
TVKTQPNPLRVSDAMAHRLARKSTAFMPQEQ

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(448-563)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 67711..106355

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LA356_RS23620 (LA356_23625) 63183..63551 + 369 WP_227255179 hypothetical protein -
LA356_RS23625 (LA356_23630) 63672..64193 - 522 WP_156107326 hypothetical protein -
LA356_RS23630 (LA356_23635) 64274..64837 - 564 WP_042313683 DUF2913 family protein -
LA356_RS23635 (LA356_23640) 64933..65472 - 540 WP_042313803 phospholipase D family protein -
LA356_RS23640 (LA356_23645) 65529..67724 - 2196 WP_052511208 F-type conjugative transfer protein TrbC -
LA356_RS23645 (LA356_23650) 67711..68727 - 1017 WP_052511207 thioredoxin fold domain-containing protein trbB
LA356_RS23650 (LA356_23655) 68781..70097 - 1317 WP_227255180 conjugal transfer protein TrbA trbA
LA356_RS24080 70241..70336 - 96 WP_042313676 DinQ-like type I toxin DqlB -
LA356_RS23655 (LA356_23660) 71013..71846 - 834 Protein_87 class I SAM-dependent methyltransferase -
LA356_RS24085 72964..73059 - 96 WP_000247680 DinQ-like type I toxin DqlB -
LA356_RS23660 (LA356_23665) 73599..74252 - 654 WP_042313669 DUF5710 domain-containing protein -
LA356_RS23665 (LA356_23670) 74630..75232 - 603 WP_042313665 hypothetical protein -
LA356_RS23670 (LA356_23675) 75229..77382 - 2154 WP_042313662 DotA/TraY family protein traY
LA356_RS23675 (LA356_23680) 77434..77952 - 519 WP_042313658 conjugal transfer protein TraX -
LA356_RS23680 (LA356_23685) 77949..79082 - 1134 WP_263986860 conjugal transfer protein TraW traW
LA356_RS23685 (LA356_23690) 79194..82256 - 3063 WP_042313652 conjugal transfer protein traU
LA356_RS23690 (LA356_23695) 82253..82861 - 609 WP_052021958 hypothetical protein traT
LA356_RS23695 (LA356_23700) 83472..83918 - 447 WP_042313650 hypothetical protein -
LA356_RS23700 (LA356_23705) 83992..84477 + 486 WP_156107325 hypothetical protein -
LA356_RS23705 (LA356_23710) 84510..84908 - 399 WP_042313644 DUF6750 family protein traR
LA356_RS23710 (LA356_23715) 84924..85454 - 531 WP_042313642 conjugal transfer protein TraQ traQ
LA356_RS23715 (LA356_23720) 85464..86213 - 750 WP_042313639 hypothetical protein traP
LA356_RS23720 (LA356_23725) 86213..87412 - 1200 WP_042313636 conjugal transfer protein TraO traO
LA356_RS23725 (LA356_23730) 87412..88431 - 1020 WP_042313634 DotH/IcmK family type IV secretion protein traN
LA356_RS23730 (LA356_23735) 88428..89105 - 678 WP_042313631 DotI/IcmL/TraM family protein traM
LA356_RS23735 (LA356_23740) 89168..89638 - 471 WP_042313629 hypothetical protein traL
LA356_RS23740 (LA356_23745) 89654..93091 - 3438 WP_042313624 DUF5710 domain-containing protein -
LA356_RS23745 (LA356_23750) 93103..93369 - 267 WP_023208014 IcmT/TraK family protein traK
LA356_RS23750 (LA356_23755) 93359..94561 - 1203 WP_227255181 plasmid transfer ATPase TraJ virB11
LA356_RS23755 (LA356_23760) 94525..95232 - 708 WP_227255182 type IV secretory system conjugative DNA transfer family protein traI
LA356_RS23760 (LA356_23765) 95343..95798 - 456 WP_042313615 DotD/TraH family lipoprotein -
LA356_RS23765 (LA356_23770) 95916..97070 - 1155 WP_042313612 site-specific integrase -
LA356_RS23770 (LA356_23775) 97425..97739 - 315 WP_138021619 hypothetical protein -
LA356_RS23775 (LA356_23780) 98911..99168 + 258 Protein_112 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
LA356_RS23780 (LA356_23785) 99252..99635 - 384 Protein_113 phage tail protein -
LA356_RS23785 (LA356_23790) 100037..100636 - 600 WP_227255184 DapH/DapD/GlmU-related protein -
LA356_RS23790 (LA356_23795) 100600..101934 - 1335 WP_216436919 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
LA356_RS23795 (LA356_23800) 102033..102644 - 612 WP_042313905 prepilin peptidase -
LA356_RS23800 (LA356_23805) 102644..103114 - 471 WP_042313902 lytic transglycosylase domain-containing protein virB1
LA356_RS23805 (LA356_23810) 103128..103721 - 594 WP_052511213 type 4 pilus major pilin -
LA356_RS23810 (LA356_23815) 103748..104863 - 1116 WP_052511212 type II secretion system F family protein -
LA356_RS23815 (LA356_23820) 104856..106355 - 1500 WP_042313899 GspE/PulE family protein virB11
LA356_RS23820 (LA356_23825) 106387..106743 - 357 WP_052511211 type IV pilus biogenesis protein PilP -
LA356_RS23825 (LA356_23830) 106910..108193 - 1284 WP_042313897 type 4b pilus protein PilO2 -
LA356_RS23830 (LA356_23835) 108198..109646 - 1449 WP_227255193 PilN family type IVB pilus formation outer membrane protein -
LA356_RS23835 (LA356_23840) 109592..109777 + 186 WP_227255185 hypothetical protein -
LA356_RS23840 (LA356_23845) 109755..110264 - 510 WP_227255186 type IV pilus biogenesis protein PilM -
LA356_RS23845 (LA356_23850) 110264..110746 - 483 WP_227255187 toxin co-regulated pilus biosynthesis Q family protein -
LA356_RS23850 (LA356_23855) 110868..111254 - 387 WP_227255188 hypothetical protein -

Host bacterium

ID   17314 GenBank   NZ_CP084373
Plasmid name   FDAARGOS_1524|unnamed1 Incompatibility group   -
Plasmid size   116662 bp Coordinate of oriT [Strand]   55295..55377 [+]
Host baterium   Citrobacter werkmanii strain FDAARGOS_1524

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -