Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   116738
Name   oriT_pTZ27 in_silico
Organism   Staphylococcus capitis strain TZ27
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP098660 (2980..3015 [-], 36 nt)
oriT length   36 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 36 nt

>oriT_pTZ27
CACGCGATCGGAACGTTCGCATAAGTGCACCCTTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   10672 GenBank   WP_030061449
Name   MobA_MobL_ND730_RS00030_pTZ27 insolico UniProt ID   A0A848EWD6
Length   665 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 665 a.a.        Molecular weight: 78725.60 Da        Isoelectric Point: 5.1613

>WP_030061449.1 MULTISPECIES: MobA/MobL family protein [Staphylococcus]
MAMYHFQNKFVSKANGQSATAKAAYNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWN
KVNDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINDENPHAHLLCTLRG
LDKNNEFEPKRKGNDYIRDWNTKDKHNEWRKRWETVQNKHLEMNGFSVRVSADSYKKQNIDLEPTKKEGW
KARKFEDETGKKSSISKHNESIKKRNQQKINKMFDEVDDMKSHKLNAFSYMDKSDSTTLKDMAKDLKIYV
TPINMYEENERLYDLKQKTALITDDEDRLNKIENIEDRQKKLESINEVFEKQAGIFFDKNYPEQALNYSD
DEKIFITRTILNDRDVLPANHELEDIVKEKRIKEAQISLNTVIGNRDISIESIEKESNFFADKLSNILDK
NNLSFDDVLENKHEGIEDSLKIDYYTSKLEVLRNAENTLEDYYDVQIKELFTDDEDYKAFNEVTDIKEKQ
QLIDFKTYHGTENTLEMLETGNFIPKYSDEDRKYITEQVKLLQEKEFKPNKNQHDKFVFGAIQKKLLNEY
DFDYSDNNDLKHLYQESNEVGDETSKDNIEEFYEGNDILVDKETYNNYNRKQQAYGLVNAGLDSMIFNFN
EIFRERMPKYINNQYKGKNHSKQRHELKNKRGMHL

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(17-216)

Nicking enzyme C-terminal middle helical domain (NES_C_h)

(265-359)


  Protein structure


Source ID Structure
AlphaFold DB A0A848EWD6


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 24410..30282

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND730_RS00105 20541..20675 - 135 WP_254903663 hypothetical protein -
ND730_RS00110 (ND730_00105) 20888..21400 - 513 WP_032495402 MerR family transcriptional regulator -
ND730_RS00115 (ND730_00110) 21403..22575 - 1173 WP_032495458 IS256-like element ISEnfa4 family transposase -
ND730_RS00120 (ND730_00115) 22661..23899 - 1239 WP_263654396 DNA topoisomerase III -
ND730_RS00125 (ND730_00120) 23915..24400 - 486 WP_000735570 TrsH/TraH family protein -
ND730_RS00130 (ND730_00125) 24410..25486 - 1077 WP_030061480 CHAP domain-containing protein trsG
ND730_RS00135 (ND730_00130) 25504..26784 - 1281 WP_030061477 hypothetical protein trsF
ND730_RS00140 (ND730_00135) 26796..28808 - 2013 WP_030061475 VirB4 family type IV secretion system protein virb4
ND730_RS00145 (ND730_00140) 28829..29512 - 684 WP_030061473 TrsD/TraD family conjugative transfer protein trsD
ND730_RS00150 (ND730_00145) 29499..29906 - 408 WP_030061471 hypothetical protein trsC
ND730_RS00155 (ND730_00150) 29965..30282 - 318 WP_030061469 CagC family type IV secretion system protein virB2
ND730_RS00160 (ND730_00155) 30299..31273 - 975 WP_030061467 conjugative transfer protein TrsA -
ND730_RS00165 (ND730_00160) 31446..31634 + 189 WP_030061465 hypothetical protein -
ND730_RS00170 (ND730_00165) 31738..32697 - 960 WP_030061463 replication initiator protein A -

Host bacterium

ID   17171 GenBank   NZ_CP098660
Plasmid name   pTZ27 Incompatibility group   -
Plasmid size   32697 bp Coordinate of oriT [Strand]   2980..3015 [-]
Host baterium   Staphylococcus capitis strain TZ27

Cargo genes

Drug resistance gene   aac(6')-aph(2''), cfr
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21