Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   116733
Name   oriT_Gp200|unnamed2 in_silico
Organism   Yersinia enterocolitica strain Gp200
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP107090 (1102..1159 [+], 58 nt)
oriT length   58 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 58 nt

>oriT_Gp200|unnamed2
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   10667 GenBank   WP_263697569
Name   Relaxase_N4226_RS21015_Gp200|unnamed2 insolico UniProt ID   _
Length   225 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 225 a.a.        Molecular weight: 24771.10 Da        Isoelectric Point: 9.2235

>WP_263697569.1 relaxase/mobilization nuclease domain-containing protein, partial [Yersinia enterocolitica]
MIVKFHPRGRGGGGGPVDYLLGKDRQRDGASVLQGKPDEVRELIDASPYAKKYTSGVLSFAEQDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHRDKGRLELNFLIPNTELLTGKRLQPYYDRAARPRIDAWQTIVN
GRLGLHDPNAPENRRVLVSPSALPEAKQEAAQAITSGLLALASSGELKTRQDVTEALESAGFEVVRTTKS
SISIADPDGGRNIRL

  Protein domains


Predicted by InterproScan.

(57-215)


  Protein structure



No available structure.




Auxiliary protein


ID   6292 GenBank   WP_004193914
Name   WP_004193914_Gp200|unnamed2 insolico UniProt ID   A0A8T3UXZ2
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11783.55 Da        Isoelectric Point: 7.8963

>WP_004193914.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCEGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQIVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   17166 GenBank   NZ_CP107090
Plasmid name   Gp200|unnamed2 Incompatibility group   Col440II
Plasmid size   1176 bp Coordinate of oriT [Strand]   1102..1159 [+]
Host baterium   Yersinia enterocolitica strain Gp200

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -