Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 116522 |
| Name | oriT_5zf15-2-1|p5ZF15-2-1 |
| Organism | Escherichia fergusonii strain 5zf15-2-1 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP079893 (13740..13792 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_5zf15-2-1|p5ZF15-2-1
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 12329 | GenBank | WP_015059539 |
| Name | t4cp2_KYD87_RS25130_5zf15-2-1|p5ZF15-2-1 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 32071..56235
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KYD87_RS25070 (KYD87_24930) | 27472..28125 | - | 654 | WP_170855322 | hypothetical protein | - |
| KYD87_RS25075 (KYD87_24935) | 28137..29261 | - | 1125 | WP_000486716 | site-specific integrase | - |
| KYD87_RS25080 (KYD87_24940) | 30175..31419 | - | 1245 | WP_000750517 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| KYD87_RS25085 (KYD87_24945) | 31432..32067 | - | 636 | WP_000934977 | A24 family peptidase | - |
| KYD87_RS25090 (KYD87_24950) | 32071..32553 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| KYD87_RS25095 (KYD87_24955) | 32619..33176 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
| KYD87_RS25100 (KYD87_24960) | 33221..34330 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| KYD87_RS25105 (KYD87_24965) | 34321..35859 | - | 1539 | WP_000466225 | GspE/PulE family protein | virB11 |
| KYD87_RS25110 (KYD87_24970) | 35884..36378 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| KYD87_RS25115 (KYD87_24975) | 36362..37672 | - | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
| KYD87_RS25120 (KYD87_24980) | 37723..39366 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| KYD87_RS25125 (KYD87_24985) | 39359..39901 | - | 543 | WP_001220544 | sigma 54-interacting transcriptional regulator | virb4 |
| KYD87_RS25130 (KYD87_24990) | 39948..41906 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| KYD87_RS25135 (KYD87_24995) | 41922..42977 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| KYD87_RS25140 (KYD87_25000) | 42996..44135 | - | 1140 | WP_171264649 | TrbI/VirB10 family protein | virB10 |
| KYD87_RS25145 (KYD87_25005) | 44125..44826 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | virB9 |
| KYD87_RS25150 (KYD87_25010) | 44892..45626 | - | 735 | WP_000432282 | virB8 family protein | virB8 |
| KYD87_RS25155 (KYD87_25015) | 45792..48149 | - | 2358 | WP_000548955 | VirB4 family type IV secretion system protein | virb4 |
| KYD87_RS25160 (KYD87_25020) | 48155..48475 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| KYD87_RS25165 | 48546..48836 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| KYD87_RS25170 (KYD87_25030) | 48836..49420 | - | 585 | WP_001177113 | lytic transglycosylase domain-containing protein | virB1 |
| KYD87_RS25175 (KYD87_25035) | 49441..49839 | - | 399 | WP_001153665 | hypothetical protein | - |
| KYD87_RS25180 (KYD87_25040) | 49958..50395 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| KYD87_RS25185 (KYD87_25045) | 50401..51636 | - | 1236 | WP_015059538 | TcpQ domain-containing protein | - |
| KYD87_RS25190 (KYD87_25050) | 51639..51938 | - | 300 | WP_000835764 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| KYD87_RS25195 (KYD87_25055) | 52006..52287 | - | 282 | WP_000638823 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| KYD87_RS25200 (KYD87_25060) | 52277..52528 | - | 252 | WP_000121741 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| KYD87_RS25205 (KYD87_25065) | 52628..53263 | - | 636 | WP_015059536 | hypothetical protein | - |
| KYD87_RS25210 (KYD87_25070) | 53311..54102 | + | 792 | WP_023154636 | DUF5710 domain-containing protein | - |
| KYD87_RS25215 (KYD87_25075) | 54357..54581 | - | 225 | WP_000713561 | EexN family lipoprotein | - |
| KYD87_RS25220 (KYD87_25080) | 54590..55234 | - | 645 | WP_001310442 | type IV secretion system protein | - |
| KYD87_RS25225 (KYD87_25085) | 55240..56235 | - | 996 | WP_001028541 | type IV secretion system protein | virB6 |
| KYD87_RS25230 (KYD87_25090) | 56239..56496 | - | 258 | WP_000739144 | hypothetical protein | - |
| KYD87_RS25235 (KYD87_25095) | 56493..56795 | - | 303 | WP_001360345 | hypothetical protein | - |
| KYD87_RS25240 (KYD87_25100) | 57066..57278 | - | 213 | WP_039022940 | hypothetical protein | - |
| KYD87_RS25245 (KYD87_25105) | 57289..57459 | - | 171 | WP_000550720 | hypothetical protein | - |
| KYD87_RS25250 (KYD87_25110) | 57463..57906 | - | 444 | WP_072037179 | NfeD family protein | - |
| KYD87_RS25255 (KYD87_25115) | 58280..59233 | - | 954 | WP_072109880 | SPFH domain-containing protein | - |
| KYD87_RS25260 (KYD87_25120) | 59260..59436 | - | 177 | WP_000753050 | hypothetical protein | - |
| KYD87_RS25265 (KYD87_25125) | 59429..59644 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| KYD87_RS25270 (KYD87_25130) | 59637..60089 | - | 453 | WP_223666486 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 16955 | GenBank | NZ_CP079893 |
| Plasmid name | 5zf15-2-1|p5ZF15-2-1 | Incompatibility group | IncI2 |
| Plasmid size | 61228 bp | Coordinate of oriT [Strand] | 13740..13792 [-] |
| Host baterium | Escherichia fergusonii strain 5zf15-2-1 |
Cargo genes
| Drug resistance gene | mcr-1.1 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |