Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   116269
Name   oriT_ES-1276|unnamed1 in_silico
Organism   Enterococcus faecalis strain ES-1276
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP136347 (27213..27262 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_ES-1276|unnamed1
AATATCGCAACATGGTACCATGTTGCTCTGCTCGCAAAAAGAAAGCCTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   10405 GenBank   WP_002367932
Name   Relaxase_RX139_RS14570_ES-1276|unnamed1 insolico UniProt ID   R3K157
Length   561 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 561 a.a.        Molecular weight: 65400.15 Da        Isoelectric Point: 6.0174

>WP_002367932.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterococcus]
MVYTKHFVIHTFDKLNNACSYIENAEKTEVTNDNPSEHLEHLFQYIVNDDKTYMKKLVSGHGIVDPTNPY
EEFKLTKLQAAIQRKIGYTFDPKSERLLPPTLTELEKGNAVLAHHLIQSFSPEDDLTPEKIHEIGYNTVM
ELTGGEYEFVIATHVDKEHLHNHIIFSSTNLKTGKAFRWQKGTKKVFEQISDKIAAKEGAKIIEKSPKNS
HKKYTMWETESLYKEKIKSRLDFLLEQSSSINDFLEKAEALNLSVDFSKKWTTYRLLDEPQIKNTRSRSL
SKSDPTRYNYEKIVERLKENKSVLTLKEVVEKYVEKSEKSKNEFDYQLTIDEWQISHKTTRGYYVNVDFG
FGERGKVFIGAYKVDPLENGQYNIYVKRKDFFYLMNEKNADRNRYMTGETLIKQLRLYNGQTPLKKEPVM
RTIDELVNAINFLAANEIEDTRQLELLEEKLEAAFLEAEETLETLDEKMLELHQLSNLLLENELNGELEL
IQQKLKTLLPDATLAEFSYEDVRGEIEAIKTSQSLLENKLERTRNEINQLHEIQAVQKKETANQNNVKPK
L

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(37-296)


  Protein structure


Source ID Structure
AlphaFold DB R3K157


Auxiliary protein

ID   6116 GenBank   WP_002367696
Name   WP_002367696_ES-1276|unnamed1 insolico UniProt ID   Q82YL4
Length   118 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 118 a.a.        Molecular weight: 14042.10 Da        Isoelectric Point: 9.9724

>WP_002367696.1 MULTISPECIES: plasmid mobilization relaxosome protein MobC [Bacteria]
MENKQKLKRPIQRKIRFSKEENELINRKIEESFFPNFQNFALHLLIQGEIRHVDYSELNRLTTEIHKIGI
NINQMARLANQFHEISSEDIKDLTDKVQSLNALVQSELNKLIKRKEQS

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(64-105)


  Protein structure


Source ID Structure
AlphaFold DB Q82YL4


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 31735..48654

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RX139_RS14575 (RX139_14575) 26790..27146 - 357 WP_002367696 plasmid mobilization relaxosome protein MobC -
RX139_RS14580 (RX139_14580) 27392..27664 - 273 WP_002362409 LtrD -
RX139_RS14585 (RX139_14585) 27697..29856 - 2160 WP_010815744 ArdC-like ssDNA-binding domain-containing protein -
RX139_RS14590 (RX139_14590) 29907..31735 - 1829 Protein_40 type IV secretory system conjugative DNA transfer family protein -
RX139_RS14595 (RX139_14595) 31735..32220 - 486 WP_002386493 PcfB family protein gbs1365
RX139_RS14600 (RX139_14600) 32262..32444 - 183 WP_002367689 hypothetical protein -
RX139_RS14605 (RX139_14605) 32490..32948 - 459 WP_002382810 single-stranded DNA-binding protein -
RX139_RS14610 (RX139_14610) 32965..33720 - 756 WP_002415346 Fic family protein -
RX139_RS14615 (RX139_14615) 33834..34442 - 609 WP_010815741 hypothetical protein -
RX139_RS14620 (RX139_14620) 34426..34671 - 246 WP_002410289 hypothetical protein -
RX139_RS14625 (RX139_14625) 34658..35284 - 627 WP_002386490 hypothetical protein prgL
RX139_RS14630 (RX139_14630) 35308..37923 - 2616 WP_172500139 phage tail tip lysozyme prgK
RX139_RS14635 (RX139_14635) 37935..40325 - 2391 WP_010815738 VirB4-like conjugal transfer ATPase, CD1110 family virb4
RX139_RS14640 (RX139_14640) 40279..40632 - 354 WP_002367919 PrgI family mobile element protein prgIc
RX139_RS14645 (RX139_14645) 40634..41434 - 801 WP_002367679 type IV secretion system protein prgHb
RX139_RS14650 (RX139_14650) 41449..41745 - 297 WP_172500140 type III secretion system protein PrgG -
RX139_RS14655 (RX139_14655) 41758..41985 - 228 WP_002365858 hypothetical protein -
RX139_RS14660 (RX139_14660) 42032..42466 - 435 WP_172500141 type III secretion system protein PrgE -
RX139_RS14665 (RX139_14665) 42487..43383 - 897 WP_172500142 type III secretion system protein PrgD -
RX139_RS14670 (RX139_14670) 43425..44282 - 858 WP_002367673 pheromone response LPXTG-anchored adhesin PrgC prgC
RX139_RS14675 (RX139_14675) 44310..44666 - 357 WP_002367672 pheromone response system RNA-binding regulator PrgU -
RX139_RS14680 (RX139_14680) 44728..48654 - 3927 WP_172500143 LPXTG-anchored aggregation substance PrgB/Asc10 prgB
RX139_RS14685 (RX139_14685) 48880..49467 - 588 WP_142430344 hypothetical protein -
RX139_RS14690 (RX139_14690) 49536..52208 - 2673 WP_172500144 surface exclusion protein SEA1/PrgA -
RX139_RS14695 (RX139_14695) 52219..52524 - 306 WP_010715949 hypothetical protein -
RX139_RS14700 (RX139_14700) 52826..53047 - 222 WP_002386480 hypothetical protein -
RX139_RS14705 (RX139_14705) 53098..53478 - 381 WP_172500145 type III secretion system protein PrgR -

Host bacterium

ID   16702 GenBank   NZ_CP136347
Plasmid name   ES-1276|unnamed1 Incompatibility group   -
Plasmid size   66560 bp Coordinate of oriT [Strand]   27213..27262 [-]
Host baterium   Enterococcus faecalis strain ES-1276

Cargo genes

Drug resistance gene   -
Virulence gene   prgB/asc10
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA9