Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   116261
Name   oriT_ESA302|p2 in_silico
Organism   Escherichia albertii strain ESA302
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP136260 (39082..39134 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_ESA302|p2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTCTCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   12138 GenBank   WP_316441401
Name   t4cp2_RXE34_RS25350_ESA302|p2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73461.99 Da        Isoelectric Point: 9.3370

>WP_316441401.1 type IV secretory system conjugative DNA transfer family protein [Escherichia albertii]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKIIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGYTAGYNLRFVFILQNEGQGQKSDMYGQEGWTTFTENSGVVLY
YPPKSKNSLAKKISEEIGVRDMKISKRSVSSGGGNTGTSRTRNDEIIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(127-591)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 4783..22079

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RXE34_RS25270 (RXE34_25270) 104..895 - 792 WP_022645137 DUF5710 domain-containing protein -
RXE34_RS25275 (RXE34_25275) 943..1575 + 633 WP_001419736 hypothetical protein -
RXE34_RS25280 (RXE34_25280) 1675..1926 + 252 WP_000121741 type II toxin-antitoxin system Phd/YefM family antitoxin -
RXE34_RS25285 (RXE34_25285) 1916..2197 + 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
RXE34_RS25290 (RXE34_25290) 2265..2564 + 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
RXE34_RS25295 (RXE34_25295) 2567..3802 + 1236 WP_045146393 TcpQ domain-containing protein -
RXE34_RS25300 (RXE34_25300) 3808..4245 + 438 WP_000539665 type IV pilus biogenesis protein PilM -
RXE34_RS25305 (RXE34_25305) 4364..4762 + 399 WP_097728036 hypothetical protein -
RXE34_RS25310 (RXE34_25310) 4783..5367 + 585 WP_097728035 lytic transglycosylase domain-containing protein virB1
RXE34_RS25315 (RXE34_25315) 5367..5657 + 291 WP_063268638 conjugal transfer protein -
RXE34_RS25320 (RXE34_25320) 5728..6048 + 321 WP_000362081 VirB3 family type IV secretion system protein virB3
RXE34_RS25325 (RXE34_25325) 6054..8411 + 2358 WP_103809047 VirB4 family type IV secretion system protein virb4
RXE34_RS25330 (RXE34_25330) 8575..9309 + 735 WP_103809048 virB8 family protein virB8
RXE34_RS25335 (RXE34_25335) 9375..10076 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein virB9
RXE34_RS25340 (RXE34_25340) 10066..11205 + 1140 WP_103809049 TrbI/VirB10 family protein virB10
RXE34_RS25345 (RXE34_25345) 11224..12279 + 1056 WP_103809050 P-type DNA transfer ATPase VirB11 virB11
RXE34_RS25350 (RXE34_25350) 12295..14253 + 1959 WP_316441401 type IV secretory system conjugative DNA transfer family protein -
RXE34_RS25355 (RXE34_25355) 14300..14791 + 492 WP_106509037 ATP-binding protein virb4
RXE34_RS25360 (RXE34_25360) 14784..16427 + 1644 WP_106509036 PilN family type IVB pilus formation outer membrane protein -
RXE34_RS25365 (RXE34_25365) 16478..17788 + 1311 WP_001454111 type 4b pilus protein PilO2 -
RXE34_RS25370 (RXE34_25370) 17772..18266 + 495 WP_045146418 type IV pilus biogenesis protein PilP -
RXE34_RS25375 (RXE34_25375) 18291..19829 + 1539 WP_045146419 GspE/PulE family protein virB11
RXE34_RS25380 (RXE34_25380) 19820..20929 + 1110 WP_000974900 type II secretion system F family protein -
RXE34_RS25385 (RXE34_25385) 20974..21531 + 558 WP_106509035 type 4 pilus major pilin -
RXE34_RS25390 (RXE34_25390) 21597..22079 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
RXE34_RS25395 (RXE34_25395) 22083..22718 + 636 WP_106509034 A24 family peptidase -
RXE34_RS25400 (RXE34_25400) 22731..24017 + 1287 WP_316441402 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
RXE34_RS25405 (RXE34_25405) 25030..26154 + 1125 WP_106509043 site-specific integrase -
RXE34_RS25410 (RXE34_25410) 26166..26819 + 654 WP_202615546 hypothetical protein -

Host bacterium

ID   16694 GenBank   NZ_CP136260
Plasmid name   ESA302|p2 Incompatibility group   IncI2
Plasmid size   66386 bp Coordinate of oriT [Strand]   39082..39134 [+]
Host baterium   Escherichia albertii strain ESA302

Cargo genes

Drug resistance gene   blaCTX-M-55
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -