Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   116225
Name   oriT_pB77-CPsm in_silico
Organism   Serratia marcescens strain B77-CPsm
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MN913381 (8376..8481 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_pB77-CPsm
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   10380 GenBank   WP_004187323
Name   traI_IAU36_RS00095_pB77-CPsm insolico UniProt ID   A0A3U8KUL3
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U8KUL3


T4CP

ID   12117 GenBank   WP_004206885
Name   t4cp2_IAU36_RS00210_pB77-CPsm insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79538.91 Da        Isoelectric Point: 4.8317

>WP_004206885.1 MULTISPECIES: conjugal transfer protein TrbC [Enterobacterales]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMRFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFAEWLDGTETDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 11277..38620

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IAU36_RS00075 6361..6672 + 312 WP_004187333 hypothetical protein -
IAU36_RS00080 6805..7341 + 537 WP_004187332 hypothetical protein -
IAU36_RS00085 7843..8238 - 396 WP_019725163 hypothetical protein -
IAU36_RS00455 8237..8800 + 564 WP_020277892 plasmid mobilization protein MobA -
IAU36_RS00095 8787..10766 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
IAU36_RS00100 10780..11280 + 501 WP_004187320 DotD/TraH family lipoprotein -
IAU36_RS00105 11277..12056 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
IAU36_RS00110 12067..13230 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
IAU36_RS00115 13220..13480 + 261 WP_004187310 IcmT/TraK family protein traK
IAU36_RS00460 13505..16942 + 3438 WP_225373171 LPD7 domain-containing protein -
IAU36_RS00125 16866..17420 + 555 WP_011154467 hypothetical protein traL
IAU36_RS00130 17421..17618 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
IAU36_RS00135 17605..18015 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
IAU36_RS00140 18014..18796 + 783 WP_015058941 DotI/IcmL family type IV secretion protein traM
IAU36_RS00145 18805..19956 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
IAU36_RS00150 19968..21317 + 1350 WP_004187474 conjugal transfer protein TraO traO
IAU36_RS00155 21329..22033 + 705 WP_015060002 conjugal transfer protein TraP traP
IAU36_RS00160 22057..22587 + 531 WP_004187478 conjugal transfer protein TraQ traQ
IAU36_RS00165 22604..22993 + 390 WP_004187479 DUF6750 family protein traR
IAU36_RS00170 23039..23533 + 495 WP_004187480 hypothetical protein -
IAU36_RS00175 23530..26580 + 3051 WP_004187482 hypothetical protein traU
IAU36_RS00180 26577..27785 + 1209 WP_011091082 conjugal transfer protein TraW traW
IAU36_RS00185 27782..28378 + 597 WP_015060003 hypothetical protein -
IAU36_RS00190 28371..30566 + 2196 WP_015062834 DotA/TraY family protein traY
IAU36_RS00195 30568..31221 + 654 WP_015060005 hypothetical protein -
IAU36_RS00200 31290..31532 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -
IAU36_RS00205 31816..32883 + 1068 WP_019725043 plasmid replication initiator RepA -
IAU36_RS00475 34106..34201 + 96 WP_004206884 DinQ-like type I toxin DqlB -
IAU36_RS00210 34252..36339 - 2088 WP_004206885 conjugal transfer protein TrbC -
IAU36_RS00215 36352..37302 - 951 WP_004206886 DsbC family protein trbB
IAU36_RS00220 37313..38620 - 1308 WP_015059988 hypothetical protein trbA
IAU36_RS00225 38620..38976 - 357 WP_015586032 lytic transglycosylase domain-containing protein -
IAU36_RS00230 39120..39515 - 396 WP_015059989 DUF1496 domain-containing protein -
IAU36_RS00235 39583..40236 + 654 WP_004206890 CPBP family intramembrane glutamic endopeptidase -
IAU36_RS00240 40328..40585 + 258 WP_004187429 type II toxin-antitoxin system antitoxin PemI -
IAU36_RS00245 40554..40919 + 366 WP_020277900 type II toxin-antitoxin system toxin endoribonuclease PemK-mt -
IAU36_RS00250 41012..41446 + 435 WP_004187425 LexA family transcriptional regulator -
IAU36_RS00255 41434..42699 + 1266 WP_021242902 translesion error-prone DNA polymerase V subunit UmuC -
IAU36_RS00260 42822..43031 - 210 WP_004187413 hypothetical protein -
IAU36_RS00265 43034..43252 - 219 WP_004187411 hypothetical protein -

Host bacterium

ID   16658 GenBank   NZ_MN913381
Plasmid name   pB77-CPsm Incompatibility group   IncL/M
Plasmid size   65114 bp Coordinate of oriT [Strand]   8376..8481 [+]
Host baterium   Serratia marcescens strain B77-CPsm

Cargo genes

Drug resistance gene   blaVIM-1, dfrB1, ant(3'')-Ia, catB2, qacE, sul1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -