Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 116187
• Name: oriT_pLFE1
• Organism: Lactiplantibacillus plantarum
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NC_012628 (3245..3282 [+], 38 nt)
• oriT length: 38 nt
• IRs (inverted repeats): 12..19, 26..33 (AAAGTATA..TATACTTT) 1..6, 10..15 (CTTTAC..GTAAAG)
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 38 nt

>oriT_pLFE1
CTTTACGAAGTAAAGTATAGTGGGTTATACTTTGCATG

oriT secondary structure

Predicted by RNAfold.

Relaxase

Mob_Pre_HS554_RS00035_pLFE1

• ID: 10351
• GenBank: WP_012718312
• Name: Mob_Pre_HS554_RS00035_pLFE1
• UniProt ID: C3U0I6
• Length: 83 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 83 a.a.
• Molecular weight: 9612.70 Da
• Isoelectric Point: 10.0915

>WP_012718312.1 plasmid recombination protein [Lactiplantibacillus plantarum]
MSFVVARMQKVKSGNLVGVGNHNQRNTDNHSNKDIDVERSHLNYDLVNRTENYKRDIEQFINDNKSSSRA
VRKDAVLINERVL

Protein domains

Predicted by InterproScan.

• Plasmid recombination enzyme (Mob_Pre) (1-82)

Protein structure

• AlphaFold DB: C3U0I6

Host bacterium

• ID: 16620
• GenBank: NC_012628
• Plasmid name: pLFE1
• Incompatibility group: -
• Plasmid size: 4031 bp
• Coordinate of oriT [Strand]: 3245..3282 [+]
• Host baterium: Lactiplantibacillus plantarum

Cargo genes

• Drug resistance gene: erm(B)
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -