Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   116183
Name   oriT_pECD227_112 in_silico
Organism   Escherichia fergusonii ECD227
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CM001143 (58049..58135 [-], 87 nt)
oriT length   87 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 87 nt

>oriT_pECD227_112
GGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   12094 GenBank   WP_001289276
Name   trbC_ECD227_RS00935_pECD227_112 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86941.11 Da        Isoelectric Point: 6.7713

>WP_001289276.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 60870..98004

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECD227_RS27285 56103..56300 - 198 WP_001161115 hypothetical protein -
ECD227_RS00945 (ECD227_4148) 56649..57497 + 849 WP_001077023 DUF4942 domain-containing protein -
ECD227_RS00940 (ECD227_4149) 57583..57918 - 336 WP_000157095 molybdopterin-guanine dinucleotide biosynthesis protein MobC -
ECD227_RS23295 58151..58412 + 262 WP_001281050 plasmid mobilization protein MobA -
ECD227_RS00935 (ECD227_4150) 58586..60877 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
ECD227_RS00930 (ECD227_4151) 60870..61940 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
ECD227_RS00925 (ECD227_4152) 61959..63167 - 1209 WP_000121274 IncI1-type conjugal transfer protein TrbA trbA
ECD227_RS23300 63459..63611 + 153 WP_001331364 Hok/Gef family protein -
ECD227_RS27290 63683..63874 - 192 WP_174715448 hypothetical protein -
ECD227_RS27295 64434..64529 + 96 WP_000609148 DinQ-like type I toxin DqlB -
ECD227_RS26760 64594..64770 - 177 WP_001054904 hypothetical protein -
ECD227_RS23315 65162..65371 + 210 WP_000062603 HEAT repeat domain-containing protein -
ECD227_RS00915 (ECD227_4154) 65443..66105 - 663 WP_000653334 plasmid IncI1-type surface exclusion protein ExcA -
ECD227_RS00910 (ECD227_4155) 66170..68332 - 2163 WP_000698351 DotA/TraY family protein traY
ECD227_RS00905 (ECD227_4156) 68429..69013 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
ECD227_RS00900 (ECD227_4157) 69042..70244 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
ECD227_RS23320 (ECD227_4158) 70211..70825 - 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
ECD227_RS00895 (ECD227_4159) 70825..73869 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
ECD227_RS00890 (ECD227_4160) 73959..74759 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
ECD227_RS23325 74743..74931 - 189 WP_001277255 putative conjugal transfer protein TraS -
ECD227_RS00885 (ECD227_4161) 74995..75399 - 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
ECD227_RS00880 (ECD227_4162) 75450..75977 - 528 WP_001055569 conjugal transfer protein TraQ traQ
ECD227_RS00875 (ECD227_4163) 75977..76681 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
ECD227_RS00870 (ECD227_4164) 76681..77970 - 1290 WP_001272005 conjugal transfer protein TraO traO
ECD227_RS00865 (ECD227_4165) 77973..78956 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
ECD227_RS00860 (ECD227_4166) 78967..79659 - 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
ECD227_RS00855 (ECD227_4167) 79656..80003 - 348 WP_001055900 conjugal transfer protein traL
ECD227_RS00850 (ECD227_4168) 80021..83788 - 3768 WP_001141528 LPD7 domain-containing protein -
ECD227_RS23330 (ECD227_4169) 83878..84429 - 552 WP_000014583 phospholipase D family protein -
ECD227_RS25265 84444..84734 - 291 WP_001299214 hypothetical protein traK
ECD227_RS00845 (ECD227_4170) 84731..85879 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
ECD227_RS23335 85876..86694 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
ECD227_RS23340 86691..87149 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
ECD227_RS00840 (ECD227_4171) 87544..88128 - 585 WP_000977522 histidine phosphatase family protein -
ECD227_RS00835 (ECD227_4172) 88188..89390 - 1203 WP_000976351 conjugal transfer protein TraF -
ECD227_RS00830 (ECD227_4173) 89475..90299 - 825 WP_001238939 conjugal transfer protein TraE traE
ECD227_RS00825 (ECD227_4174) 90450..91604 - 1155 WP_001139957 tyrosine-type recombinase/integrase -
ECD227_RS27125 91771..91977 + 207 WP_000326764 hypothetical protein -
ECD227_RS25275 91974..92312 - 339 WP_072109855 hypothetical protein -
ECD227_RS23345 92413..93498 - 1086 WP_001498285 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
ECD227_RS23350 (ECD227_4186) 93498..94154 - 657 WP_001193553 prepilin peptidase -
ECD227_RS23355 94139..94699 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
ECD227_RS23360 (ECD227_4187) 94709..95323 - 615 WP_000959785 type 4 pilus major pilin -
ECD227_RS23365 95341..96438 - 1098 WP_001208805 type II secretion system F family protein -
ECD227_RS00820 (ECD227_4188) 96451..98004 - 1554 WP_000362202 GspE/PulE family protein virB11
ECD227_RS00815 (ECD227_4189) 98015..98467 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
ECD227_RS23370 98454..99749 - 1296 WP_000752774 type 4b pilus protein PilO2 -
ECD227_RS23375 99742..101424 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
ECD227_RS00810 (ECD227_4190) 101438..101875 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
ECD227_RS00805 (ECD227_4191) 101875..102942 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   16616 GenBank   NZ_CM001143
Plasmid name   pECD227_112 Incompatibility group   IncI1
Plasmid size   112394 bp Coordinate of oriT [Strand]   58049..58135 [-]
Host baterium   Escherichia fergusonii ECD227

Cargo genes


Drug resistance gene   tet(A), sul1, qacE, aac(3)-VIa, ant(3'')-Ia
Virulence gene   htpB
Metal resistance gene   merR, merT, merP, merA, merD, merE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -