Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   115953
Name   oriT_pOHT403-4_1 in_silico
Organism   Enterobacter hormaechei strain OHT403-4
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP135277 (162926..162975 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pOHT403-4_1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   10202 GenBank   WP_102000654
Name   traI_RRJ53_RS23490_pOHT403-4_1 insolico UniProt ID   _
Length   1752 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 1752 a.a.        Molecular weight: 190481.24 Da        Isoelectric Point: 6.1898

>WP_102000654.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MLSFSQVKSAGSAGNYYTEKDNYYVIGSMEERWQGKGAELLGLEGKVDKQVFTELLQGKLPDGSDLTRIQ
DGVNKHRPGYDLTFSAPKSVSMLAMLGGDKRLIDAHNRAVTVALNQVESLASTRVKKDGVSETVLTGNLI
IARFNHDTSRAQDPQIHTHSVVINATQNGDKWQTLASDTVGKTGFSETILANRIAFGKIYQNSLRADVES
MGYKTVDAGRNGMWEMEGVPVESFSTRSQELREAAGPDASLKSRDVAALDTRKSKEAIDPAEKMVEWMNT
LKETGFDIRGYREAADARAAELARAPAAPVNTDGPDITDVVTKAIAGLSDRKVQFTYADLLARTVGQLEA
KDGVFDLARKGIDAAIEREQLIPLDREKGLFTSNIHVLDELAVKALSQEVQRQNHVSVTPDASVVRQVPF
SDAVSVLAQDRPVMGIVSGQGGATGQRERVAELTLMAREQGRDVHILAADNRSRDFLAGDVRLAGETVTG
KSALQDGTAFIPGGTLIVDQAEKLSLKETISLLDGAMRHNVQVLLSDSGKRSGTGSALTVLKDSGVNTYR
WQGGHQTTADIISEPDKGARYSRLAQEFAVSVREGQESVAQISGTREQSVLNGLIRDSLRQEGVLGEKDT
TITALTPVWLDSKSRGVRDYYREGMVMERWDPETRTHDRFVIDRVTASSNMLTLKDREGDRLDLKVSAVD
SQWTLFRADTLPVAEGERLVVLGKIPDTRLKGGESITVMKVEDGQLTVQRPGQKTTQALAAGAGVFDGIK
VGHGWVESPGRSVSETATVFASVTQRELDNATLNQLAQSGSHLRLYSAQDAARTTEKLSRHTAFSVVSEQ
LKSRSGETDLDTAIAQQKAGLHTPAEQAIHLAIPLLESQDLTFSRPQLLATAMETGGGKVSMADIDTTIQ
AQIRSGQLLNVPVAHGYGNDLLISRQTWDAEKSILTHVLEGKGAVAPLMDRVPASLMTDLTAGQRAATRM
ILESTDRFTVVQGYAGVGKTTQFRAVMSAISLLPEETRPRVIGLAPTHRAVGEMQSAGVEARTTASFLHD
TQLLQRNGQIPDFSNTLFLLDESSMVGLADMAKAHSLIVAGGGRAVSSGDNDQLQPIAPGQPFRLMQQRS
AADVAIMKEIVRQVPELRPAVYSLIERDVHRALTTIEQVTPEQVPRKEGVWAPGSSVVEFTPKQEKAIEK
ALSEGKTLPEGQPASLYEALVKDYTGRTPEAQSQTLVITHLNKDRRALNSLIHDARRENGETGKEEITLP
VLVTSNIRDGELRKLSTWTAHKEAVALVDNVYHRISKVDKDNQLITLTDSEGKERFISPREASAEGVTLY
RQEKITVSQGDRMRFSKSDPERGYVANSIWEVQSVSGDSVTLSDGKLTRTLTPKADQAQQHIDLAYAITA
HGAQGASEPYAIALEGGAGGREQMASFESAYVALSRMKQHVQVYTDSREGWIKAIQHSPEKATAHDILEP
RNDRAVKSADLLFGRARPLDETAAGRAALQQSGLAQGSSPGRFISPGKKYPQPHVALPAFDKNGKAAGIW
LSPLTDRDGRLEAIGGEGRIMGNEDARFVALQNSRNGESLLAGNMGEGVRMARDNPDTGVVVRLAGDDRP
WNPGAITGGRVWAEPAPVAPVPQAGADIILPPEVLAQRAAEEQQRREMEKQAEQTAREVAGEARKAGEPA
DRVKEVIGDVIRGLERDRPVTEKTTLPDDPQFRRQEAAIQQVASVRLQRERLQAVERDMVRDLNREKTLG
GD

  Protein domains


Predicted by InterproScan.

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(576-628)

TrwC relaxase (TrwC)

(11-283)

DNA helicase TraI (TraI_C)

(1432-1554)

AAA domain (AAA_30)

(970-1156)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(634-713)


  Protein structure



No available structure.




T4CP

ID   11912 GenBank   WP_094309621
Name   traD_RRJ53_RS23495_pOHT403-4_1 insolico UniProt ID   _
Length   760 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 760 a.a.        Molecular weight: 84847.80 Da        Isoelectric Point: 5.0065

>WP_094309621.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTAWCGEQLWTGFVFAATVSIVICIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSPPA
PAEMTVSPAPVKAPPTTKRPAAEPPVLPVTPIPLLKPKAAAAAATASSAGTPAAAAGGTEQELAQQSAEQ
GQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 97040..107328

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RRJ53_RS23230 (RRJ53_23230) 93099..94100 - 1002 WP_095153357 plasmid replication initiator RepA -
RRJ53_RS23235 (RRJ53_23235) 94259..94330 - 72 WP_071786674 RepA leader peptide Tap -
RRJ53_RS23240 (RRJ53_23240) 94542..94811 - 270 WP_022631531 replication regulatory protein RepA -
RRJ53_RS23245 (RRJ53_23245) 94947..95498 - 552 WP_029497441 phospholipase D family protein -
RRJ53_RS23250 (RRJ53_23250) 95602..95703 - 102 Protein_112 hypothetical protein -
RRJ53_RS23255 (RRJ53_23255) 95757..96461 - 705 WP_001067858 IS6-like element IS26 family transposase -
RRJ53_RS23260 (RRJ53_23260) 96498..97043 - 546 WP_315434847 phospholipase D family protein -
RRJ53_RS23265 (RRJ53_23265) 97040..98041 - 1002 WP_001076634 ATPase, T2SS/T4P/T4SS family virB11
RRJ53_RS23270 (RRJ53_23270) 98092..99225 - 1134 WP_000101920 type IV secretion system protein VirB10 virB10
RRJ53_RS23275 (RRJ53_23275) 99225..100112 - 888 WP_000758230 TrbG/VirB9 family P-type conjugative transfer protein virB9
RRJ53_RS23280 (RRJ53_23280) 100123..100818 - 696 WP_001208352 type IV secretion system protein virB8
RRJ53_RS23285 (RRJ53_23285) 101037..102074 - 1038 WP_014014948 type IV secretion system protein virB6
RRJ53_RS23290 (RRJ53_23290) 102091..102333 - 243 WP_000858958 EexN family lipoprotein -
RRJ53_RS23295 (RRJ53_23295) 102343..103056 - 714 WP_000644929 type IV secretion system protein virB5
RRJ53_RS23300 (RRJ53_23300) 103072..105645 - 2574 WP_032493176 VirB4 family type IV secretion/conjugal transfer ATPase virb4
RRJ53_RS23305 (RRJ53_23305) 105646..105963 - 318 WP_000462629 type IV secretion system protein VirB3 virB3
RRJ53_RS23310 (RRJ53_23310) 106003..106299 - 297 WP_015060075 TrbC/VirB2 family protein virB2
RRJ53_RS23315 (RRJ53_23315) 106546..107328 - 783 WP_024562119 lytic transglycosylase domain-containing protein virB1
RRJ53_RS23320 (RRJ53_23320) 107428..107745 + 318 WP_000960955 H-NS family nucleoid-associated regulatory protein -
RRJ53_RS23325 (RRJ53_23325) 107749..108099 + 351 WP_000528713 hypothetical protein -
RRJ53_RS23330 (RRJ53_23330) 108096..108434 + 339 WP_000040982 hypothetical protein -
RRJ53_RS23335 (RRJ53_23335) 108438..108746 + 309 WP_000733764 hypothetical protein -
RRJ53_RS23340 (RRJ53_23340) 109031..109216 + 186 WP_024562121 ribbon-helix-helix domain-containing protein -
RRJ53_RS23345 (RRJ53_23345) 109213..109821 - 609 WP_000275218 recombinase family protein -
RRJ53_RS23350 (RRJ53_23350) 109987..110319 - 333 WP_000140165 hypothetical protein -
RRJ53_RS23355 (RRJ53_23355) 110459..111343 + 885 WP_000807122 replication protein RepA -

Region 2: 134567..163533

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RRJ53_RS23495 (RRJ53_23495) 134567..136849 - 2283 WP_094309621 type IV conjugative transfer system coupling protein TraD virb4
RRJ53_RS23500 (RRJ53_23500) 136976..137665 - 690 WP_181672279 hypothetical protein -
RRJ53_RS23505 (RRJ53_23505) 137858..138589 - 732 WP_004152629 conjugal transfer complement resistance protein TraT -
RRJ53_RS23510 (RRJ53_23510) 138777..139304 - 528 WP_040120388 conjugal transfer protein TraS -
RRJ53_RS23515 (RRJ53_23515) 139310..142159 - 2850 WP_117062995 conjugal transfer mating-pair stabilization protein TraG traG
RRJ53_RS23520 (RRJ53_23520) 142159..143538 - 1380 WP_072198320 conjugal transfer pilus assembly protein TraH traH
RRJ53_RS23525 (RRJ53_23525) 143516..143959 - 444 WP_065801492 F-type conjugal transfer protein TrbF -
RRJ53_RS23530 (RRJ53_23530) 144005..144562 - 558 WP_065801493 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
RRJ53_RS23535 (RRJ53_23535) 144534..144773 - 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
RRJ53_RS23540 (RRJ53_23540) 144784..145536 - 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
RRJ53_RS23545 (RRJ53_23545) 145557..145883 - 327 WP_004152676 hypothetical protein -
RRJ53_RS23550 (RRJ53_23550) 145896..146144 - 249 WP_117062994 hypothetical protein -
RRJ53_RS23555 (RRJ53_23555) 146122..146376 - 255 WP_004152674 conjugal transfer protein TrbE -
RRJ53_RS23560 (RRJ53_23560) 146408..148363 - 1956 WP_117062993 type-F conjugative transfer system mating-pair stabilization protein TraN traN
RRJ53_RS23565 (RRJ53_23565) 148422..149060 - 639 WP_065801495 type-F conjugative transfer system pilin assembly protein TrbC trbC
RRJ53_RS23570 (RRJ53_23570) 149073..150062 - 990 WP_046664201 conjugal transfer pilus assembly protein TraU traU
RRJ53_RS23575 (RRJ53_23575) 150059..150460 - 402 WP_004194979 hypothetical protein -
RRJ53_RS23580 (RRJ53_23580) 150495..151130 - 636 WP_032441885 type-F conjugative transfer system protein TraW traW
RRJ53_RS23585 (RRJ53_23585) 151130..151519 - 390 WP_004167468 type-F conjugative transfer system protein TrbI -
RRJ53_RS23590 (RRJ53_23590) 151519..154158 - 2640 WP_087786333 type IV secretion system protein TraC virb4
RRJ53_RS23595 (RRJ53_23595) 154230..154628 - 399 WP_074188112 hypothetical protein -
RRJ53_RS23600 (RRJ53_23600) 154636..154935 - 300 WP_055322554 hypothetical protein -
RRJ53_RS23605 (RRJ53_23605) 154978..155382 - 405 WP_065801498 hypothetical protein -
RRJ53_RS23610 (RRJ53_23610) 155449..155760 - 312 WP_065801499 hypothetical protein -
RRJ53_RS23615 (RRJ53_23615) 155761..155979 - 219 WP_004195468 hypothetical protein -
RRJ53_RS23620 (RRJ53_23620) 156302..156885 - 584 Protein_186 type IV conjugative transfer system lipoprotein TraV -
RRJ53_RS23625 (RRJ53_23625) 156908..157504 - 597 WP_065801501 conjugal transfer pilus-stabilizing protein TraP -
RRJ53_RS23630 (RRJ53_23630) 157497..158921 - 1425 WP_016529134 F-type conjugal transfer pilus assembly protein TraB traB
RRJ53_RS23635 (RRJ53_23635) 158921..159661 - 741 WP_315434859 type-F conjugative transfer system secretin TraK traK
RRJ53_RS23640 (RRJ53_23640) 159648..160214 - 567 WP_004152602 type IV conjugative transfer system protein TraE traE
RRJ53_RS23645 (RRJ53_23645) 160234..160539 - 306 WP_004178059 type IV conjugative transfer system protein TraL traL
RRJ53_RS23650 (RRJ53_23650) 160553..160921 - 369 WP_064147976 type IV conjugative transfer system pilin TraA -
RRJ53_RS23655 (RRJ53_23655) 160983..161189 - 207 WP_172412524 TraY domain-containing protein -
RRJ53_RS23660 (RRJ53_23660) 161322..162041 - 720 WP_023320098 hypothetical protein -
RRJ53_RS23665 (RRJ53_23665) 162241..162657 - 417 WP_074181767 conjugal transfer relaxosome DNA-binding protein TraM -
RRJ53_RS23670 (RRJ53_23670) 163048..163533 + 486 WP_065801502 transglycosylase SLT domain-containing protein virB1
RRJ53_RS23675 (RRJ53_23675) 163566..163895 - 330 WP_011977736 DUF5983 family protein -
RRJ53_RS23680 (RRJ53_23680) 163928..164749 - 822 WP_065801503 DUF932 domain-containing protein -
RRJ53_RS23685 (RRJ53_23685) 165583..165996 - 414 WP_004182074 type II toxin-antitoxin system HigA family antitoxin -
RRJ53_RS23690 (RRJ53_23690) 165997..166275 - 279 WP_004152721 helix-turn-helix transcriptional regulator -
RRJ53_RS23695 (RRJ53_23695) 166265..166585 - 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
RRJ53_RS23700 (RRJ53_23700) 166666..166890 - 225 WP_065801604 hypothetical protein -
RRJ53_RS23705 (RRJ53_23705) 166901..167113 - 213 WP_019706020 hypothetical protein -
RRJ53_RS23710 (RRJ53_23710) 167174..167530 - 357 WP_019706019 hypothetical protein -

Host bacterium

ID   16386 GenBank   NZ_CP135277
Plasmid name   pOHT403-4_1 Incompatibility group   IncFIB
Plasmid size   178751 bp Coordinate of oriT [Strand]   162926..162975 [+]
Host baterium   Enterobacter hormaechei strain OHT403-4

Cargo genes

Drug resistance gene   tet(A)
Virulence gene   iutA, iucD, iucC, iucB, iucA, cseA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9