Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   115787
Name   oriT_pSU277_3 in_silico
Organism   Sinorhizobium medicae strain SU277
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP104150 (177035..177091 [-], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pSU277_3
GCAGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCCAATTGTGAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   11814 GenBank   WP_127626075
Name   t4cp2_N2598_RS31590_pSU277_3 insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77755.63 Da        Isoelectric Point: 9.8116

>WP_127626075.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium medicae]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQFWHYKTSPALQKVALGS
LVPAMLVAGLVAYIGLKPTSSPLGDAAFQDMASLRRGKWFRKQGHIFGRVGRNILRTRDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGAISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKESYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLAPKPVPATTP
EYAKGGDPSVEIPSLAPAKEEKPLTAAAAKAVPVKAERAADEKAAAPAKRTVNRQALRTNPKATAANTGG
AEASASLDAMEARIKAIEEGLKPKAAQLKEVVETKAEKLGDKSPTKRRNILDIFSATVPDPVEVGVTAE

  Protein domains


Predicted by InterproScan.

(103-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 273937..283150

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2598_RS31510 (N2598_31510) 270549..270953 - 405 WP_127626065 hypothetical protein -
N2598_RS31515 (N2598_31515) 270954..271654 - 701 Protein_296 thermonuclease family protein -
N2598_RS31520 (N2598_31520) 271651..272187 - 537 WP_127626066 thermonuclease family protein -
N2598_RS31525 (N2598_31525) 272184..272792 - 609 WP_102033093 hypothetical protein -
N2598_RS31530 (N2598_31530) 273014..273925 + 912 WP_164855759 lytic transglycosylase domain-containing protein -
N2598_RS31535 (N2598_31535) 273937..274275 + 339 WP_127626067 TrbC/VirB2 family protein virB2
N2598_RS31540 (N2598_31540) 274279..274578 + 300 WP_127626068 type IV secretion system protein VirB3 virB3
N2598_RS31545 (N2598_31545) 274581..276671 + 2091 Protein_302 VirB4 family type IV secretion system protein -
N2598_RS32540 276670..277416 + 747 Protein_303 lytic transglycosylase domain-containing protein -
N2598_RS31555 (N2598_31555) 277428..278129 + 702 WP_127626069 type IV secretion system protein -
N2598_RS31560 (N2598_31560) 278119..278346 + 228 WP_127626070 hypothetical protein -
N2598_RS31565 (N2598_31565) 278362..279390 + 1029 WP_127626071 type IV secretion system protein virB6
N2598_RS31570 (N2598_31570) 279429..280124 + 696 WP_127626072 virB8 family protein virB8
N2598_RS31575 (N2598_31575) 280121..280933 + 813 WP_127626073 P-type conjugative transfer protein VirB9 virB9
N2598_RS31580 (N2598_31580) 280930..282141 + 1212 WP_127626074 type IV secretion system protein VirB10 virB10
N2598_RS31585 (N2598_31585) 282122..283150 + 1029 WP_014531068 P-type DNA transfer ATPase VirB11 virB11
N2598_RS31590 (N2598_31590) 283147..285246 + 2100 WP_127626075 type IV secretory system conjugative DNA transfer family protein -
N2598_RS31595 (N2598_31595) 286337..286756 - 420 Protein_312 IS5 family transposase -
N2598_RS31600 (N2598_31600) 286687..286929 - 243 WP_231234275 hypothetical protein -
N2598_RS31605 (N2598_31605) 286951..287118 - 168 WP_164830104 transposase -


Host bacterium


ID   16220 GenBank   NZ_CP104150
Plasmid name   pSU277_3 Incompatibility group   -
Plasmid size   366163 bp Coordinate of oriT [Strand]   177035..177091 [-]
Host baterium   Sinorhizobium medicae strain SU277

Cargo genes


Drug resistance gene   -
Virulence gene   htpB
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -