Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 115569 |
| Name | oriT_pMB8590_1  |
| Organism | Klebsiella michiganensis strain 5088 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP103555 (170014..170063 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pMB8590_1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 11624 | GenBank | WP_023313941 |
| Name | traD_M5R35_RS28720_pMB8590_1 |
UniProt ID | _ |
| Length | 769 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85666.78 Da Isoelectric Point: 5.2499
>WP_023313941.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 139670..170621
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R35_RS28720 (M5R35_28720) | 139670..141979 | - | 2310 | WP_023313941 | type IV conjugative transfer system coupling protein TraD | virb4 |
| M5R35_RS28725 (M5R35_28725) | 142106..142795 | - | 690 | WP_013023831 | hypothetical protein | - |
| M5R35_RS28730 (M5R35_28730) | 142988..143422 | - | 435 | Protein_153 | complement resistance protein TraT | - |
| M5R35_RS28735 (M5R35_28735) | 143437..144405 | + | 969 | WP_015958259 | IS5 family transposase | - |
| M5R35_RS28740 (M5R35_28740) | 144462..144783 | - | 322 | Protein_155 | complement resistance protein TraT | - |
| M5R35_RS28745 (M5R35_28745) | 144972..145499 | - | 528 | WP_032409657 | conjugal transfer protein TraS | - |
| M5R35_RS28750 (M5R35_28750) | 145505..148354 | - | 2850 | WP_023287129 | conjugal transfer mating-pair stabilization protein TraG | traG |
| M5R35_RS28755 (M5R35_28755) | 148354..149733 | - | 1380 | WP_072159474 | conjugal transfer pilus assembly protein TraH | traH |
| M5R35_RS28760 (M5R35_28760) | 149711..150154 | - | 444 | WP_023287131 | F-type conjugal transfer protein TrbF | - |
| M5R35_RS28765 (M5R35_28765) | 150200..150757 | - | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| M5R35_RS28770 (M5R35_28770) | 150729..150968 | - | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| M5R35_RS28775 (M5R35_28775) | 150979..151731 | - | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| M5R35_RS28780 (M5R35_28780) | 151752..152078 | - | 327 | WP_004152676 | hypothetical protein | - |
| M5R35_RS28785 (M5R35_28785) | 152091..152339 | - | 249 | WP_013214029 | hypothetical protein | - |
| M5R35_RS28790 (M5R35_28790) | 152317..152571 | - | 255 | WP_023287133 | conjugal transfer protein TrbE | - |
| M5R35_RS28795 (M5R35_28795) | 152603..154558 | - | 1956 | WP_023287134 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| M5R35_RS28800 (M5R35_28800) | 154617..155264 | - | 648 | WP_064757794 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| M5R35_RS28805 (M5R35_28805) | 155343..155519 | - | 177 | WP_162866177 | hypothetical protein | - |
| M5R35_RS28810 (M5R35_28810) | 155540..156529 | - | 990 | WP_032439620 | conjugal transfer pilus assembly protein TraU | traU |
| M5R35_RS28815 (M5R35_28815) | 156526..156927 | - | 402 | WP_016831047 | hypothetical protein | - |
| M5R35_RS28820 (M5R35_28820) | 156962..157597 | - | 636 | WP_020325113 | type-F conjugative transfer system protein TraW | traW |
| M5R35_RS28825 (M5R35_28825) | 157597..157986 | - | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| M5R35_RS28830 (M5R35_28830) | 157986..160625 | - | 2640 | WP_032448278 | type IV secretion system protein TraC | virb4 |
| M5R35_RS28835 (M5R35_28835) | 160697..161095 | - | 399 | WP_072159473 | hypothetical protein | - |
| M5R35_RS28840 (M5R35_28840) | 161103..161492 | - | 390 | WP_065799586 | hypothetical protein | - |
| M5R35_RS28845 (M5R35_28845) | 161535..161939 | - | 405 | WP_016831042 | hypothetical protein | - |
| M5R35_RS28850 (M5R35_28850) | 162006..162317 | - | 312 | WP_014386200 | hypothetical protein | - |
| M5R35_RS28855 (M5R35_28855) | 162318..162536 | - | 219 | WP_014386199 | hypothetical protein | - |
| M5R35_RS28860 (M5R35_28860) | 162560..162850 | - | 291 | WP_014386198 | hypothetical protein | - |
| M5R35_RS28865 (M5R35_28865) | 162855..163265 | - | 411 | WP_014386197 | hypothetical protein | - |
| M5R35_RS28870 (M5R35_28870) | 163396..163980 | - | 585 | WP_014386196 | type IV conjugative transfer system lipoprotein TraV | traV |
| M5R35_RS28875 (M5R35_28875) | 164027..164599 | - | 573 | WP_014386195 | conjugal transfer pilus-stabilizing protein TraP | - |
| M5R35_RS28880 (M5R35_28880) | 164592..166016 | - | 1425 | WP_014386194 | F-type conjugal transfer pilus assembly protein TraB | traB |
| M5R35_RS28885 (M5R35_28885) | 166016..166756 | - | 741 | WP_014386193 | type-F conjugative transfer system secretin TraK | traK |
| M5R35_RS28890 (M5R35_28890) | 166743..167309 | - | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
| M5R35_RS28895 (M5R35_28895) | 167329..167634 | - | 306 | WP_049110928 | type IV conjugative transfer system protein TraL | traL |
| M5R35_RS28900 (M5R35_28900) | 167648..168016 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| M5R35_RS28905 (M5R35_28905) | 168078..168284 | - | 207 | WP_171773970 | TraY domain-containing protein | - |
| M5R35_RS28910 (M5R35_28910) | 168417..169136 | - | 720 | WP_014386192 | conjugal transfer protein | - |
| M5R35_RS28915 (M5R35_28915) | 169329..169745 | - | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M5R35_RS28920 (M5R35_28920) | 170136..170621 | + | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
| M5R35_RS28925 (M5R35_28925) | 170654..170983 | - | 330 | WP_014386191 | DUF5983 family protein | - |
| M5R35_RS28930 (M5R35_28930) | 171016..171837 | - | 822 | WP_004182076 | DUF932 domain-containing protein | - |
| M5R35_RS28935 (M5R35_28935) | 172670..173083 | - | 414 | WP_013023817 | type II toxin-antitoxin system HigA family antitoxin | - |
| M5R35_RS28940 (M5R35_28940) | 173084..173362 | - | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| M5R35_RS28945 (M5R35_28945) | 173352..173672 | - | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M5R35_RS28950 (M5R35_28950) | 173753..173977 | - | 225 | WP_014386189 | hypothetical protein | - |
| M5R35_RS28955 (M5R35_28955) | 173988..174200 | - | 213 | WP_014386188 | hypothetical protein | - |
| M5R35_RS28960 (M5R35_28960) | 174262..174588 | - | 327 | WP_014386187 | hypothetical protein | - |
Host bacterium
| ID | 16002 | GenBank | NZ_CP103555 |
| Plasmid name | pMB8590_1 | Incompatibility group | IncFIB |
| Plasmid size | 188758 bp | Coordinate of oriT [Strand] | 170014..170063 [+] |
| Host baterium | Klebsiella michiganensis strain 5088 |
Cargo genes
| Drug resistance gene | sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1B, blaCTX-M-15, dfrA14, blaOXA-1, aac(6')-Ib-cr, tet(A), qnrB1, aac(3)-IIa |
| Virulence gene | - |
| Metal resistance gene | silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsB, arsC, arsH |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |