Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   115551
Name   oriT_pMB5971_1 in_silico
Organism   Klebsiella aerogenes strain 722
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP103640 (152105..152154 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pMB5971_1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   11616 GenBank   WP_023313941
Name   traD_M5T48_RS25920_pMB5971_1 insolico UniProt ID   _
Length   769 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 769 a.a.        Molecular weight: 85666.78 Da        Isoelectric Point: 5.2499

>WP_023313941.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

(172-560)

(32-128)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 121761..152712

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T48_RS25920 (M5T48_25920) 121761..124070 - 2310 WP_023313941 type IV conjugative transfer system coupling protein TraD virb4
M5T48_RS25925 (M5T48_25925) 124197..124886 - 690 WP_013023831 hypothetical protein -
M5T48_RS25930 (M5T48_25930) 125079..125513 - 435 Protein_135 complement resistance protein TraT -
M5T48_RS25935 (M5T48_25935) 125528..126496 + 969 WP_015958259 IS5 family transposase -
M5T48_RS25940 (M5T48_25940) 126553..126874 - 322 Protein_137 complement resistance protein TraT -
M5T48_RS25945 (M5T48_25945) 127063..127590 - 528 WP_032409657 conjugal transfer protein TraS -
M5T48_RS25950 (M5T48_25950) 127596..130445 - 2850 WP_023287129 conjugal transfer mating-pair stabilization protein TraG traG
M5T48_RS25955 (M5T48_25955) 130445..131824 - 1380 WP_072159474 conjugal transfer pilus assembly protein TraH traH
M5T48_RS25960 (M5T48_25960) 131802..132245 - 444 WP_023287131 F-type conjugal transfer protein TrbF -
M5T48_RS25965 (M5T48_25965) 132291..132848 - 558 WP_013214031 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
M5T48_RS25970 (M5T48_25970) 132820..133059 - 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
M5T48_RS25975 (M5T48_25975) 133070..133822 - 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
M5T48_RS25980 (M5T48_25980) 133843..134169 - 327 WP_004152676 hypothetical protein -
M5T48_RS25985 (M5T48_25985) 134182..134430 - 249 WP_013214029 hypothetical protein -
M5T48_RS25990 (M5T48_25990) 134408..134662 - 255 WP_023287133 conjugal transfer protein TrbE -
M5T48_RS25995 (M5T48_25995) 134694..136649 - 1956 WP_023287134 type-F conjugative transfer system mating-pair stabilization protein TraN traN
M5T48_RS26000 (M5T48_26000) 136708..137355 - 648 WP_064757794 type-F conjugative transfer system pilin assembly protein TrbC trbC
M5T48_RS26005 (M5T48_26005) 137631..138620 - 990 WP_032439620 conjugal transfer pilus assembly protein TraU traU
M5T48_RS26010 (M5T48_26010) 138617..139018 - 402 WP_016831047 hypothetical protein -
M5T48_RS26015 (M5T48_26015) 139053..139688 - 636 WP_020325113 type-F conjugative transfer system protein TraW traW
M5T48_RS26020 (M5T48_26020) 139688..140077 - 390 WP_004167468 type-F conjugative transfer system protein TrbI -
M5T48_RS26025 (M5T48_26025) 140077..142716 - 2640 WP_032448278 type IV secretion system protein TraC virb4
M5T48_RS26030 (M5T48_26030) 142788..143186 - 399 WP_072159473 hypothetical protein -
M5T48_RS26035 (M5T48_26035) 143194..143583 - 390 WP_065799586 hypothetical protein -
M5T48_RS26040 (M5T48_26040) 143626..144030 - 405 WP_016831042 hypothetical protein -
M5T48_RS26045 (M5T48_26045) 144097..144408 - 312 WP_014386200 hypothetical protein -
M5T48_RS26050 (M5T48_26050) 144409..144627 - 219 WP_014386199 hypothetical protein -
M5T48_RS26055 (M5T48_26055) 144651..144941 - 291 WP_014386198 hypothetical protein -
M5T48_RS26060 (M5T48_26060) 144946..145356 - 411 WP_014386197 hypothetical protein -
M5T48_RS26065 (M5T48_26065) 145487..146071 - 585 WP_014386196 type IV conjugative transfer system lipoprotein TraV traV
M5T48_RS26070 (M5T48_26070) 146118..146690 - 573 WP_014386195 conjugal transfer pilus-stabilizing protein TraP -
M5T48_RS26075 (M5T48_26075) 146683..148107 - 1425 WP_014386194 F-type conjugal transfer pilus assembly protein TraB traB
M5T48_RS26080 (M5T48_26080) 148107..148847 - 741 WP_014386193 type-F conjugative transfer system secretin TraK traK
M5T48_RS26085 (M5T48_26085) 148834..149400 - 567 WP_004152602 type IV conjugative transfer system protein TraE traE
M5T48_RS26090 (M5T48_26090) 149420..149725 - 306 WP_049110928 type IV conjugative transfer system protein TraL traL
M5T48_RS26095 (M5T48_26095) 149739..150107 - 369 WP_004194426 type IV conjugative transfer system pilin TraA -
M5T48_RS26100 (M5T48_26100) 150169..150375 - 207 WP_171773970 TraY domain-containing protein -
M5T48_RS26105 (M5T48_26105) 150508..151227 - 720 WP_014386192 conjugal transfer protein -
M5T48_RS26110 (M5T48_26110) 151420..151836 - 417 WP_072145360 conjugal transfer relaxosome DNA-binding protein TraM -
M5T48_RS26115 (M5T48_26115) 152227..152712 + 486 WP_004178063 transglycosylase SLT domain-containing protein virB1
M5T48_RS26120 (M5T48_26120) 152745..153074 - 330 WP_014386191 DUF5983 family protein -
M5T48_RS26125 (M5T48_26125) 153107..153928 - 822 WP_004182076 DUF932 domain-containing protein -
M5T48_RS26130 (M5T48_26130) 154761..155174 - 414 WP_013023817 type II toxin-antitoxin system HigA family antitoxin -
M5T48_RS26135 (M5T48_26135) 155175..155453 - 279 WP_004152721 helix-turn-helix transcriptional regulator -
M5T48_RS26140 (M5T48_26140) 155443..155763 - 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
M5T48_RS26145 (M5T48_26145) 155844..156068 - 225 WP_014386189 hypothetical protein -
M5T48_RS26150 (M5T48_26150) 156079..156291 - 213 WP_014386188 hypothetical protein -
M5T48_RS26155 (M5T48_26155) 156353..156679 - 327 WP_014386187 hypothetical protein -


Host bacterium


ID   15984 GenBank   NZ_CP103640
Plasmid name   pMB5971_1 Incompatibility group   IncFIB
Plasmid size   170849 bp Coordinate of oriT [Strand]   152105..152154 [+]
Host baterium   Klebsiella aerogenes strain 722

Cargo genes


Drug resistance gene   sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1B, blaCTX-M-15, dfrA14, blaOXA-1, aac(6')-Ib-cr, tet(A), qnrB1, aac(3)-IIa
Virulence gene   -
Metal resistance gene   silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsB, arsC, arsH
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -