Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 115502 |
Name | oriT_EB6|unnamed |
Organism | Enterobacter hormaechei strain EB6 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP133858 (217..302 [+], 86 nt) |
oriT length | 86 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 86 nt
>oriT_EB6|unnamed
GGGTGTCGGGGCGGAGCCCTGACCAGGTGGCATTTGTAATATCGTGCGTGCGCGGTATTACAAATGCACATCCTGTCCCGTCTTTT
GGGTGTCGGGGCGGAGCCCTGACCAGGTGGCATTTGTAATATCGTGCGTGCGCGGTATTACAAATGCACATCCTGTCCCGTCTTTT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 11577 | GenBank | WP_063613185 |
Name | trbC_RHB97_RS02285_EB6|unnamed | UniProt ID | _ |
Length | 766 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 766 a.a. Molecular weight: 87542.75 Da Isoelectric Point: 6.6730
>WP_063613185.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MNYTPVNQALMKRNAWNSPVLELLRDHLLYAGIMAGSVVAGFIWPLAIPLLLLLAIVASISFGTHRWRMP
MRMPVHLNKVDPSEDRKVRRSLFRRFPSLFQYETTQESKGKGIFYLGYRRMNDIGRELWLTIDDLTRHVM
FFASTGGGKTETIYAWMLNSFCWGRGFTFVDGKAQNDTARTCYYLARRFGREDDVEYINFMNSGMSRSEM
IHNGDKSRPQSHQWNPFCYSTEAFVAETMQSMLPTNVQGGEWQSRAIAMNKALVFGTKFYCVRENKTMSL
QLLREFMPLEKLAELYCRAIDDQWPEEAVSPLYNYLVDVPGFDMATVRQPSAWTEEPRKQHSYLTGQFLE
TFNTFTETFGNIFAEDAGDIDIRDSIHSDRILLVLIPAMNTSQHTTSALGRMFVTQQSMILARDLGHRLE
GLDSEALEITKYKGPFPYMNYLDEVGAYYTERIAVQATQVRSLDFSIVMMSQDQERIESQTSATNVATLM
QNAGTKVAGKIVSDDKTAKTITNAAGQEARANMVSLQRRDGIIGTSWIDGDHINIQMENKINVQDLIKLQ
PGENYTVFQGDPVPGASFYIEPQDKTCNAPVIINRYITINPPNLKQLRKLVPRTAQRRLPAPENVSKIIG
VLTEKPSRRGKAAKAEPWKIIDTFQQRLANRQEAHNLMTEYDTDHHGREENLWEEALEVIRTTTMAERTI
RYITLNKPESEPTQVSAEEIQLAPDAILRTLTLPQPAYIPPSRYRNEPFISPKLPDSPHPDMEWPE
MNYTPVNQALMKRNAWNSPVLELLRDHLLYAGIMAGSVVAGFIWPLAIPLLLLLAIVASISFGTHRWRMP
MRMPVHLNKVDPSEDRKVRRSLFRRFPSLFQYETTQESKGKGIFYLGYRRMNDIGRELWLTIDDLTRHVM
FFASTGGGKTETIYAWMLNSFCWGRGFTFVDGKAQNDTARTCYYLARRFGREDDVEYINFMNSGMSRSEM
IHNGDKSRPQSHQWNPFCYSTEAFVAETMQSMLPTNVQGGEWQSRAIAMNKALVFGTKFYCVRENKTMSL
QLLREFMPLEKLAELYCRAIDDQWPEEAVSPLYNYLVDVPGFDMATVRQPSAWTEEPRKQHSYLTGQFLE
TFNTFTETFGNIFAEDAGDIDIRDSIHSDRILLVLIPAMNTSQHTTSALGRMFVTQQSMILARDLGHRLE
GLDSEALEITKYKGPFPYMNYLDEVGAYYTERIAVQATQVRSLDFSIVMMSQDQERIESQTSATNVATLM
QNAGTKVAGKIVSDDKTAKTITNAAGQEARANMVSLQRRDGIIGTSWIDGDHINIQMENKINVQDLIKLQ
PGENYTVFQGDPVPGASFYIEPQDKTCNAPVIINRYITINPPNLKQLRKLVPRTAQRRLPAPENVSKIIG
VLTEKPSRRGKAAKAEPWKIIDTFQQRLANRQEAHNLMTEYDTDHHGREENLWEEALEVIRTTTMAERTI
RYITLNKPESEPTQVSAEEIQLAPDAILRTLTLPQPAYIPPSRYRNEPFISPKLPDSPHPDMEWPE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 76999..111775
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RHB97_RS02105 (RHB97_02105) | 73090..73500 | + | 411 | WP_225990878 | type IV pilus biogenesis protein PilM | - |
RHB97_RS02110 (RHB97_02110) | 73515..75191 | + | 1677 | WP_032650416 | PilN family type IVB pilus formation outer membrane protein | - |
RHB97_RS02115 (RHB97_02115) | 75193..76497 | + | 1305 | WP_032650414 | type 4b pilus protein PilO2 | - |
RHB97_RS02120 (RHB97_02120) | 76481..76996 | + | 516 | WP_080298886 | type IV pilus biogenesis protein PilP | - |
RHB97_RS02125 (RHB97_02125) | 76999..78558 | + | 1560 | WP_032650411 | GspE/PulE family protein | virB11 |
RHB97_RS02130 (RHB97_02130) | 78551..79645 | + | 1095 | WP_032623575 | type II secretion system F family protein | - |
RHB97_RS02135 (RHB97_02135) | 79659..80273 | + | 615 | WP_032650407 | type 4 pilus major pilin | - |
RHB97_RS02140 (RHB97_02140) | 80358..80840 | + | 483 | WP_045261878 | lytic transglycosylase domain-containing protein | virB1 |
RHB97_RS02145 (RHB97_02145) | 80825..81499 | + | 675 | WP_032650404 | prepilin peptidase | - |
RHB97_RS02150 (RHB97_02150) | 81496..82515 | + | 1020 | Protein_110 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
RHB97_RS02155 (RHB97_02155) | 83742..84902 | + | 1161 | WP_032650572 | site-specific integrase | - |
RHB97_RS02160 (RHB97_02160) | 84922..85398 | + | 477 | WP_052686698 | hypothetical protein | - |
RHB97_RS02165 (RHB97_02165) | 85545..86381 | + | 837 | WP_050489291 | hypothetical protein | traE |
RHB97_RS02170 (RHB97_02170) | 86487..87693 | + | 1207 | Protein_114 | conjugal transfer protein TraF | - |
RHB97_RS02175 (RHB97_02175) | 87802..88218 | + | 417 | WP_127348461 | hypothetical protein | - |
RHB97_RS02180 (RHB97_02180) | 88289..88762 | + | 474 | WP_032650400 | DotD/TraH family lipoprotein | - |
RHB97_RS02185 (RHB97_02185) | 88759..89565 | + | 807 | WP_032650398 | type IV secretory system conjugative DNA transfer family protein | traI |
RHB97_RS02190 (RHB97_02190) | 89593..90738 | + | 1146 | WP_309883689 | plasmid transfer ATPase TraJ | virB11 |
RHB97_RS02195 (RHB97_02195) | 90735..91022 | + | 288 | WP_022649988 | hypothetical protein | traK |
RHB97_RS02200 (RHB97_02200) | 91094..94636 | + | 3543 | WP_032650396 | LPD7 domain-containing protein | - |
RHB97_RS02205 (RHB97_02205) | 94654..95004 | + | 351 | WP_022649990 | hypothetical protein | traL |
RHB97_RS02210 (RHB97_02210) | 95094..95711 | + | 618 | WP_179297403 | DotI/IcmL family type IV secretion protein | traM |
RHB97_RS02215 (RHB97_02215) | 95722..96702 | + | 981 | WP_032650394 | DotH/IcmK family type IV secretion protein | traN |
RHB97_RS02220 (RHB97_02220) | 96702..98009 | + | 1308 | WP_032650391 | conjugal transfer protein TraO | traO |
RHB97_RS02225 (RHB97_02225) | 97990..98763 | + | 774 | WP_123839398 | conjugal transfer protein TraP | traP |
RHB97_RS02230 (RHB97_02230) | 98763..99287 | + | 525 | WP_032650389 | conjugal transfer protein TraQ | traQ |
RHB97_RS02235 (RHB97_02235) | 99322..99726 | + | 405 | WP_022649996 | DUF6750 family protein | traR |
RHB97_RS02240 (RHB97_02240) | 99910..100635 | + | 726 | WP_065189124 | hypothetical protein | traT |
RHB97_RS02245 (RHB97_02245) | 100722..103775 | + | 3054 | WP_032650385 | conjugal transfer protein | traU |
RHB97_RS02250 (RHB97_02250) | 103772..104344 | + | 573 | WP_154816375 | conjugal transfer protein TraV | traV |
RHB97_RS02255 (RHB97_02255) | 104357..105559 | + | 1203 | WP_032650382 | conjugal transfer protein TraW | traW |
RHB97_RS02260 (RHB97_02260) | 105556..106098 | + | 543 | WP_058673440 | conjugal transfer protein TraX | - |
RHB97_RS02265 (RHB97_02265) | 106156..108315 | + | 2160 | WP_058673439 | DotA/TraY family protein | traY |
RHB97_RS02270 (RHB97_02270) | 108377..109009 | + | 633 | WP_032650376 | plasmid IncI1-type surface exclusion protein ExcA | - |
RHB97_RS02275 (RHB97_02275) | 109330..110538 | + | 1209 | WP_032650374 | hypothetical protein | trbA |
RHB97_RS02280 (RHB97_02280) | 110591..111775 | + | 1185 | WP_050489289 | thioredoxin fold domain-containing protein | trbB |
RHB97_RS02285 (RHB97_02285) | 111779..114079 | + | 2301 | WP_063613185 | F-type conjugative transfer protein TrbC | - |
RHB97_RS02290 (RHB97_02290) | 114153..114422 | + | 270 | WP_032650372 | hypothetical protein | - |
RHB97_RS02295 (RHB97_02295) | 114513..115262 | - | 750 | WP_032650370 | hypothetical protein | - |
RHB97_RS02300 (RHB97_02300) | 115327..115818 | - | 492 | WP_032650368 | type III toxin-antitoxin system ToxN/AbiQ family toxin | - |
Host bacterium
ID | 15935 | GenBank | NZ_CP133858 |
Plasmid name | EB6|unnamed | Incompatibility group | - |
Plasmid size | 119102 bp | Coordinate of oriT [Strand] | 217..302 [+] |
Host baterium | Enterobacter hormaechei strain EB6 |
Cargo genes
Drug resistance gene | - |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIIA7 |