Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   115502
Name   oriT_EB6|unnamed in_silico
Organism   Enterobacter hormaechei strain EB6
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP133858 (217..302 [+], 86 nt)
oriT length   86 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_EB6|unnamed
GGGTGTCGGGGCGGAGCCCTGACCAGGTGGCATTTGTAATATCGTGCGTGCGCGGTATTACAAATGCACATCCTGTCCCGTCTTTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   11577 GenBank   WP_063613185
Name   trbC_RHB97_RS02285_EB6|unnamed insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 87542.75 Da        Isoelectric Point: 6.6730

>WP_063613185.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MNYTPVNQALMKRNAWNSPVLELLRDHLLYAGIMAGSVVAGFIWPLAIPLLLLLAIVASISFGTHRWRMP
MRMPVHLNKVDPSEDRKVRRSLFRRFPSLFQYETTQESKGKGIFYLGYRRMNDIGRELWLTIDDLTRHVM
FFASTGGGKTETIYAWMLNSFCWGRGFTFVDGKAQNDTARTCYYLARRFGREDDVEYINFMNSGMSRSEM
IHNGDKSRPQSHQWNPFCYSTEAFVAETMQSMLPTNVQGGEWQSRAIAMNKALVFGTKFYCVRENKTMSL
QLLREFMPLEKLAELYCRAIDDQWPEEAVSPLYNYLVDVPGFDMATVRQPSAWTEEPRKQHSYLTGQFLE
TFNTFTETFGNIFAEDAGDIDIRDSIHSDRILLVLIPAMNTSQHTTSALGRMFVTQQSMILARDLGHRLE
GLDSEALEITKYKGPFPYMNYLDEVGAYYTERIAVQATQVRSLDFSIVMMSQDQERIESQTSATNVATLM
QNAGTKVAGKIVSDDKTAKTITNAAGQEARANMVSLQRRDGIIGTSWIDGDHINIQMENKINVQDLIKLQ
PGENYTVFQGDPVPGASFYIEPQDKTCNAPVIINRYITINPPNLKQLRKLVPRTAQRRLPAPENVSKIIG
VLTEKPSRRGKAAKAEPWKIIDTFQQRLANRQEAHNLMTEYDTDHHGREENLWEEALEVIRTTTMAERTI
RYITLNKPESEPTQVSAEEIQLAPDAILRTLTLPQPAYIPPSRYRNEPFISPKLPDSPHPDMEWPE

  Protein domains


Predicted by InterproScan.

(440-528)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 76999..111775

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RHB97_RS02105 (RHB97_02105) 73090..73500 + 411 WP_225990878 type IV pilus biogenesis protein PilM -
RHB97_RS02110 (RHB97_02110) 73515..75191 + 1677 WP_032650416 PilN family type IVB pilus formation outer membrane protein -
RHB97_RS02115 (RHB97_02115) 75193..76497 + 1305 WP_032650414 type 4b pilus protein PilO2 -
RHB97_RS02120 (RHB97_02120) 76481..76996 + 516 WP_080298886 type IV pilus biogenesis protein PilP -
RHB97_RS02125 (RHB97_02125) 76999..78558 + 1560 WP_032650411 GspE/PulE family protein virB11
RHB97_RS02130 (RHB97_02130) 78551..79645 + 1095 WP_032623575 type II secretion system F family protein -
RHB97_RS02135 (RHB97_02135) 79659..80273 + 615 WP_032650407 type 4 pilus major pilin -
RHB97_RS02140 (RHB97_02140) 80358..80840 + 483 WP_045261878 lytic transglycosylase domain-containing protein virB1
RHB97_RS02145 (RHB97_02145) 80825..81499 + 675 WP_032650404 prepilin peptidase -
RHB97_RS02150 (RHB97_02150) 81496..82515 + 1020 Protein_110 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
RHB97_RS02155 (RHB97_02155) 83742..84902 + 1161 WP_032650572 site-specific integrase -
RHB97_RS02160 (RHB97_02160) 84922..85398 + 477 WP_052686698 hypothetical protein -
RHB97_RS02165 (RHB97_02165) 85545..86381 + 837 WP_050489291 hypothetical protein traE
RHB97_RS02170 (RHB97_02170) 86487..87693 + 1207 Protein_114 conjugal transfer protein TraF -
RHB97_RS02175 (RHB97_02175) 87802..88218 + 417 WP_127348461 hypothetical protein -
RHB97_RS02180 (RHB97_02180) 88289..88762 + 474 WP_032650400 DotD/TraH family lipoprotein -
RHB97_RS02185 (RHB97_02185) 88759..89565 + 807 WP_032650398 type IV secretory system conjugative DNA transfer family protein traI
RHB97_RS02190 (RHB97_02190) 89593..90738 + 1146 WP_309883689 plasmid transfer ATPase TraJ virB11
RHB97_RS02195 (RHB97_02195) 90735..91022 + 288 WP_022649988 hypothetical protein traK
RHB97_RS02200 (RHB97_02200) 91094..94636 + 3543 WP_032650396 LPD7 domain-containing protein -
RHB97_RS02205 (RHB97_02205) 94654..95004 + 351 WP_022649990 hypothetical protein traL
RHB97_RS02210 (RHB97_02210) 95094..95711 + 618 WP_179297403 DotI/IcmL family type IV secretion protein traM
RHB97_RS02215 (RHB97_02215) 95722..96702 + 981 WP_032650394 DotH/IcmK family type IV secretion protein traN
RHB97_RS02220 (RHB97_02220) 96702..98009 + 1308 WP_032650391 conjugal transfer protein TraO traO
RHB97_RS02225 (RHB97_02225) 97990..98763 + 774 WP_123839398 conjugal transfer protein TraP traP
RHB97_RS02230 (RHB97_02230) 98763..99287 + 525 WP_032650389 conjugal transfer protein TraQ traQ
RHB97_RS02235 (RHB97_02235) 99322..99726 + 405 WP_022649996 DUF6750 family protein traR
RHB97_RS02240 (RHB97_02240) 99910..100635 + 726 WP_065189124 hypothetical protein traT
RHB97_RS02245 (RHB97_02245) 100722..103775 + 3054 WP_032650385 conjugal transfer protein traU
RHB97_RS02250 (RHB97_02250) 103772..104344 + 573 WP_154816375 conjugal transfer protein TraV traV
RHB97_RS02255 (RHB97_02255) 104357..105559 + 1203 WP_032650382 conjugal transfer protein TraW traW
RHB97_RS02260 (RHB97_02260) 105556..106098 + 543 WP_058673440 conjugal transfer protein TraX -
RHB97_RS02265 (RHB97_02265) 106156..108315 + 2160 WP_058673439 DotA/TraY family protein traY
RHB97_RS02270 (RHB97_02270) 108377..109009 + 633 WP_032650376 plasmid IncI1-type surface exclusion protein ExcA -
RHB97_RS02275 (RHB97_02275) 109330..110538 + 1209 WP_032650374 hypothetical protein trbA
RHB97_RS02280 (RHB97_02280) 110591..111775 + 1185 WP_050489289 thioredoxin fold domain-containing protein trbB
RHB97_RS02285 (RHB97_02285) 111779..114079 + 2301 WP_063613185 F-type conjugative transfer protein TrbC -
RHB97_RS02290 (RHB97_02290) 114153..114422 + 270 WP_032650372 hypothetical protein -
RHB97_RS02295 (RHB97_02295) 114513..115262 - 750 WP_032650370 hypothetical protein -
RHB97_RS02300 (RHB97_02300) 115327..115818 - 492 WP_032650368 type III toxin-antitoxin system ToxN/AbiQ family toxin -


Host bacterium


ID   15935 GenBank   NZ_CP133858
Plasmid name   EB6|unnamed Incompatibility group   -
Plasmid size   119102 bp Coordinate of oriT [Strand]   217..302 [+]
Host baterium   Enterobacter hormaechei strain EB6

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA7