Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   115479
Name   oriT_BFG-527|unnamed1 in_silico
Organism   Bacteroides faecis strain BFG-527
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP103142 (28354..28527 [-], 174 nt)
oriT length   174 nt
IRs (inverted repeats)      57..63, 66..72  (CAATGGC..GCCATTG)
 18..23, 37..42  (AACTAC..GTAGTT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 174 nt

>oriT_BFG-527|unnamed1
CCCTCGGGAGAGCCCACAACTACGTAAGCGGAGCGTGTAGTTATAGTGGGCTATATCAATGGCAAGCCATTGTCTGCAAACTCCAGCCTACGGCTTCCGCTCTCCTCCGTCAGGGAGGTTTTTCATCATCGTTGCCGATTGGAGATGCACCGACCAGCACAAGGTCTAAATCGT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   9912 GenBank   WP_007559083
Name   Relaxase_NXY30_RS29105_BFG-527|unnamed1 insolico UniProt ID   A0A3L7ZJB6
Length   520 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 520 a.a.        Molecular weight: 60001.99 Da        Isoelectric Point: 9.4388

>WP_007559083.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Bacteria]
MVVVVLKAATSFAGIDYNERKNEEGKSELLVAENFAMNPDNLKKSDYIAYMESVCRTNPAVKAKQFHAVI
SCKGREYSAEDLKNVALQYINKMGYGNNPYMIYFHSDTENNHVHIVSTRVQKNGQKVKDNMEAVRSQKVI
NQIMNVDLALKAKDDISKYMEFSFSTVQQYKLLLEQSGWKLREKDGLLILYKGGEKHASIQLEQIKDKAK
QYTPDEERRKQITALLFKYKQGLSYTELQTLMKDKFGINLVFHTGKGHTKPYGYTLIDYRNKRVLKGGEV
MDLKELLVEPNKQAKVEHCNSIINLLLKDGTKYTMDSFKKLMLDYGYRFSMNGTIFINGDDKALLVLDKK
LLKELRYNSRVYEANKFNVATLKEAELLSRIYHVKKDDILIQEHMDKKNTVYTDMINSYLAHSSDLHSTL
REKGILFVEDDNLVYLIDKKNKVIVSTDDLGINIIKDGYSKDRITLVTLDKMERINVEQDSELARGFNLI
DAICDILSQHINVQQDKSPNRKKKRGQQQN

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(15-143)


  Protein structure


Source ID Structure
AlphaFold DB A0A3L7ZJB6


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1..17377

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NXY30_RS28860 (NXY30_28860) 1..2841 + 2841 WP_007660146 hypothetical protein virb4
NXY30_RS28865 (NXY30_28865) 2852..3526 + 675 WP_004295374 hypothetical protein -
NXY30_RS28870 (NXY30_28870) 3528..4184 + 657 WP_007559119 hypothetical protein -
NXY30_RS28875 (NXY30_28875) 4177..5199 + 1023 WP_007559121 plasmid transfer protein traJ
NXY30_RS28880 (NXY30_28880) 5232..5846 + 615 WP_005647312 conjugative transposon protein TraK traK
NXY30_RS28885 (NXY30_28885) 5846..6277 + 432 WP_007559125 hypothetical protein -
NXY30_RS28890 (NXY30_28890) 6281..7390 + 1110 WP_007559128 conjugative transposon protein TraM traM
NXY30_RS28895 (NXY30_28895) 7392..8231 + 840 WP_004295380 conjugative transposon protein TraN traN
NXY30_RS28900 (NXY30_28900) 8244..8747 + 504 WP_007559132 hypothetical protein -
NXY30_RS28905 (NXY30_28905) 8750..9409 + 660 WP_007559134 hypothetical protein -
NXY30_RS28910 (NXY30_28910) 9412..10053 + 642 WP_007559135 OmpA family protein -
NXY30_RS28915 (NXY30_28915) 11172..11621 + 450 WP_004295329 DUF3791 domain-containing protein -
NXY30_RS28920 (NXY30_28920) 11618..12097 + 480 WP_005647329 DUF3990 domain-containing protein -
NXY30_RS28925 (NXY30_28925) 12119..12378 + 260 Protein_13 hypothetical protein -
NXY30_RS28930 (NXY30_28930) 12365..13230 + 866 Protein_14 zeta toxin family protein -
NXY30_RS28935 (NXY30_28935) 13277..13942 - 666 WP_007559149 M23 family metallopeptidase cd419a
NXY30_RS28940 (NXY30_28940) 13983..14702 + 720 WP_029425721 DUF4099 domain-containing protein -
NXY30_RS28945 (NXY30_28945) 14704..16263 + 1560 WP_007559152 DUF3945 domain-containing protein -
NXY30_RS28950 (NXY30_28950) 16268..17377 + 1110 WP_007559154 toprim domain-containing protein traP
NXY30_RS28955 (NXY30_28955) 17374..17877 + 504 WP_005647342 PH domain-containing protein -
NXY30_RS28960 (NXY30_28960) 17858..18565 + 708 WP_007559156 hypothetical protein -
NXY30_RS28965 (NXY30_28965) 18566..19402 + 837 WP_007559158 topoisomerase C-terminal repeat-containing protein -
NXY30_RS28970 (NXY30_28970) 19399..19752 + 354 WP_004295339 hypothetical protein -
NXY30_RS28975 (NXY30_28975) 19764..20042 + 279 WP_004295340 HU family DNA-binding protein -
NXY30_RS28980 (NXY30_28980) 20033..20305 + 273 WP_004295341 hypothetical protein -
NXY30_RS28985 (NXY30_28985) 20316..20759 + 444 WP_007559162 hypothetical protein -
NXY30_RS28990 (NXY30_28990) 20934..21158 + 225 WP_004295344 hypothetical protein -
NXY30_RS28995 (NXY30_28995) 21162..21965 + 804 Protein_27 YWFCY domain-containing protein -

Host bacterium

ID   15912 GenBank   NZ_CP103142
Plasmid name   BFG-527|unnamed1 Incompatibility group   -
Plasmid size   57062 bp Coordinate of oriT [Strand]   28354..28527 [-]
Host baterium   Bacteroides faecis strain BFG-527

Cargo genes

Drug resistance gene   cfxA
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -