Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   115401
Name   oriT_pR1041-ab1-275k in_silico
Organism   Acinetobacter pittii isolate R10-Ab1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OR095731 (123722..123825 [-], 104 nt)
oriT length   104 nt
IRs (inverted repeats)      63..70, 73..80  (CACCATGC..GCATGGTG)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 104 nt

>oriT_pR1041-ab1-275k
GCCCCGCAGGGCAGGATTCCCGTTGAGCGCCGCAGGTGCGAATAAGGGGAAGTGAAGAGGAACACCATGCTTGCATGGTGGGCCTACTTCACACATCCTGCCCG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   11491 GenBank   WP_042892356
Name   t4cp2_RI209_RS00810_pR1041-ab1-275k insolico UniProt ID   _
Length   930 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 930 a.a.        Molecular weight: 104210.92 Da        Isoelectric Point: 6.1065

>WP_042892356.1 MULTISPECIES: type IV secretion protein DotL [Acinetobacter]
MASTQKYGTQTKFRPSSLKRDTRSGLEKIHLKLTAPDGANYLVGVLGAIAVILFVVPFGGEIFIGIAYYL
LKRYTHPNDYFFEWPFRAPLHSNSLDASTDITSRVKDDVLDNPKAFLEYARTNRDKLQGEGVTYLGRCRE
TGLPVYASNSDDRTHQIVLGTTGSGKTEYMLGNCANQYVQNSGYIFVDAKGDTKAQQDHYRLCNRFGRNE
DLLTINFITSGRNMLRAQTDKMTNSMNQMSNTSSGMLIEFLINLLDDSGGGGGDMWKGRAMAFIAALTRV
LVYLRDNGFIQLSPKVFTQYMELEALEELVFCHNDKYGIDFERVAEQLQGYLVSLPGYSSNPKKLKKQET
KTREQHGYITMQLTKAINDLTFNYGHIFGVEHGGDIDIFDVVLNRRILTVPLPALERSPDSLKMLGKLII
GSIKQMMAGSLGNKMEGLRRAIIDARPTNATTSFKLFLDEWGYIVIVGASVLPAQARSLNFSITFGAQTF
EDIERGSKEEAAATWGNTTVKAIGRTTSGAESTTYKLVDGFAGEEWQGKVNSINMYQGLVFNRSVPQTEV
QFAKEKRVTIEQIAGQHNGEFTLLISTKGEGGKTSDVKIVSMLAFYVAGDQPKYLRLNDLCPIFNIQKSE
IYDPTLKIEDFIHEIEEKHTLLTDNNSSANVTALGDFEICRKLNNTLYENNNTVKDFTQDFVHQILEARR
LESITPEGMAPGQRTVMSSSTAKGEISKEQKHRESIVSAQKEANIKDQIIEKRKQFQYFGKDSDISPQVQ
AGAYNNADLDAEFNIYGERISEPEQAQQESDVETVTRAVITPMNLDSYYDELKEILTGYDLTVAPITEYQ
LVQIPRHVKPEDQTQYIAENKASLDQAISHSTKNEMEFVEQQYAAKFEKALMKNPFSHECVTFEKLLVIL
GSKGSSASLRSGITIKKKDD

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 145996..180867

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RI209_RS00795 (ABCDPFEC_00167) 141097..142185 - 1089 WP_065995116 DUF6685 family protein -
RI209_RS00800 (ABCDPFEC_00168) 142272..142445 - 174 WP_162900306 hypothetical protein -
RI209_RS00805 142840..143040 + 201 WP_078389757 hypothetical protein -
RI209_RS00810 (ABCDPFEC_00169) 143081..145873 - 2793 WP_042892356 type IV secretion protein DotL -
RI209_RS00815 (ABCDPFEC_00170) 145996..149178 - 3183 WP_120364225 hypothetical protein traU
RI209_RS00820 (ABCDPFEC_00171) 149236..150438 - 1203 WP_233735412 hypothetical protein -
RI209_RS00825 (ABCDPFEC_00172) 150449..151336 - 888 WP_024160797 HNH endonuclease -
RI209_RS00830 (ABCDPFEC_00173) 151447..151917 - 471 WP_309411213 hypothetical protein -
RI209_RS00835 (ABCDPFEC_00174) 152028..152603 - 576 WP_024160795 hypothetical protein -
RI209_RS00840 (ABCDPFEC_00175) 152614..153495 - 882 WP_024160794 hypothetical protein -
RI209_RS00845 (ABCDPFEC_00176) 153501..155012 - 1512 WP_024160793 DotG/IcmE/VirB10 family protein -
RI209_RS00850 (ABCDPFEC_00177) 155034..155981 - 948 WP_005005900 DotH/IcmK family type IV secretion protein traN
RI209_RS00855 (ABCDPFEC_00178) 155995..156678 - 684 WP_005005897 DotI/IcmL family type IV secretion protein traM
RI209_RS00860 (ABCDPFEC_00179) 156689..156976 - 288 WP_024160792 hypothetical protein -
RI209_RS00865 (ABCDPFEC_00180) 156977..158206 - 1230 WP_227555133 hypothetical protein -
RI209_RS00870 (ABCDPFEC_00181) 159285..159731 + 447 WP_151692142 DotD/TraH family lipoprotein -
RI209_RS00875 (ABCDPFEC_00182) 159769..160578 + 810 WP_024160789 type IV secretory system conjugative DNA transfer family protein traI
RI209_RS00880 (ABCDPFEC_00183) 160606..161901 + 1296 WP_024160788 ATPase, T2SS/T4P/T4SS family virB11
RI209_RS00885 (ABCDPFEC_00185) 162207..163313 + 1107 WP_233735410 ParM/StbA family protein -
RI209_RS00890 (ABCDPFEC_00186) 163310..164137 + 828 WP_233735409 hypothetical protein -
RI209_RS00895 (ABCDPFEC_00187) 164182..165243 - 1062 WP_005005876 ParB/RepB/Spo0J family partition protein -
RI209_RS00900 (ABCDPFEC_00188) 165253..166089 - 837 WP_032055048 ParA family protein -
RI209_RS00905 (ABCDPFEC_00189) 167540..169069 + 1530 WP_227557108 hypothetical protein trbA
RI209_RS00910 (ABCDPFEC_00190) 169192..170097 + 906 WP_005005870 hypothetical protein -
RI209_RS00915 (ABCDPFEC_00191) 170110..170784 + 675 WP_032055049 hypothetical protein -
RI209_RS00920 (ABCDPFEC_00192) 170797..171366 + 570 WP_005005866 hypothetical protein -
RI209_RS00925 (ABCDPFEC_00193) 171366..171923 + 558 WP_032055050 hypothetical protein -
RI209_RS00930 (ABCDPFEC_00194) 171927..173483 + 1557 WP_032055052 UvrD-helicase domain-containing protein -
RI209_RS00935 (ABCDPFEC_00195) 173476..174120 + 645 WP_005028658 hypothetical protein -
RI209_RS00940 (ABCDPFEC_00196) 174174..174599 - 426 WP_005005821 hypothetical protein -
RI209_RS00945 (ABCDPFEC_00197) 174614..175024 - 411 WP_005005820 hypothetical protein -
RI209_RS00950 (ABCDPFEC_00198) 175047..177059 - 2013 WP_032055054 peptidoglycan DD-metalloendopeptidase family protein traW
RI209_RS00955 (ABCDPFEC_00199) 177303..177797 + 495 WP_032055055 hypothetical protein -
RI209_RS00960 (ABCDPFEC_00200) 177859..180867 - 3009 WP_043041459 DotA/TraY family protein traY
RI209_RS00965 (ABCDPFEC_00201) 181134..181547 + 414 WP_005028668 hypothetical protein -
RI209_RS00970 (ABCDPFEC_00202) 181597..181998 + 402 WP_005005811 hypothetical protein -
RI209_RS00975 (ABCDPFEC_00203) 182047..183903 - 1857 WP_233735335 hypothetical protein -
RI209_RS00980 (ABCDPFEC_00204) 184001..184483 - 483 WP_005028671 hypothetical protein -
RI209_RS00985 (ABCDPFEC_00205) 184492..185280 - 789 WP_233735334 hypothetical protein -
RI209_RS00990 (ABCDPFEC_00206) 185234..185806 - 573 WP_166139325 hypothetical protein -


Host bacterium


ID   15834 GenBank   NZ_OR095731
Plasmid name   pR1041-ab1-275k Incompatibility group   -
Plasmid size   275647 bp Coordinate of oriT [Strand]   123722..123825 [-]
Host baterium   Acinetobacter pittii isolate R10-Ab1

Cargo genes


Drug resistance gene   aac(3)-IId, aph(3')-VIa, blaNDM-1, sul2, tet(X3), mph(E), msr(E)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2