Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   115256
Name   oriT_pAH3680 in_silico
Organism   Aeromonas hydrophila
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NC_013780 (47..105 [-], 59 nt)
oriT length   59 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 59 nt

>oriT_pAH3680
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   9748 GenBank   WP_258376221
Name   Relaxase_HS395_RS00030_pAH3680 insolico UniProt ID   _
Length   146 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 146 a.a.        Molecular weight: 16428.75 Da        Isoelectric Point: 9.3323

>WP_258376221.1 relaxase/mobilization nuclease domain-containing protein [Aeromonas hydrophila]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGATVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHADKGRLELNFLIPNTELLTGRRLQPYYDRGRPAAHRCLADHRE
RQTGAA

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(57-131)


  Protein structure



No available structure.




Auxiliary protein

ID   5721 GenBank   WP_000957084
Name   WP_000957084_pAH3680 insolico UniProt ID   Q27HK0
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11897.70 Da        Isoelectric Point: 8.5732

>WP_000957084.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCDGRQLAAWMRQICLDEKPARSGKLPSLSPALLRQLAGMGNNLNQIARRVNAG
GGTGHDRVQIVAALMAIDAGLERLRHAVLEKGTDDDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure


Source ID Structure
AlphaFold DB Q27HK0

ID   5722 GenBank   WP_258376222
Name   WP_258376222_pAH3680 insolico UniProt ID   _
Length   40 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 40 a.a.        Molecular weight: 4436.93 Da        Isoelectric Point: 4.7906

>WP_258376222.1 MbeB family mobilization protein [Aeromonas hydrophila]
MSSLLTLAKDLEQQSKAQQQSTGEMLKAAFSEHEQSVRAE

  Protein domains


Predicted by InterproScan.

MbeB-like, N-term conserved region (MbeB_N)

(1-40)


  Protein structure



No available structure.




Host bacterium

ID   15692 GenBank   NC_013780
Plasmid name   pAH3680 Incompatibility group   Col440II
Plasmid size   3680 bp Coordinate of oriT [Strand]   47..105 [-]
Host baterium   Aeromonas hydrophila

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -